CATH Domain: 1oktA02 XML data for domain: 1oktA02

Molscript image for 1oktA02
1oktA02
PDB coordinates for domain 1oktA02

PDB 1okt, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1050 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2
1.20.1050.10 Gene3D
1.20.1050.10.13
1.20.1050.10.13.1
1.20.1050.10.13.1.1
1.20.1050.10.13.1.1.2
1.20.1050.10.13.1.1.2.3

[top]
Segment boundaries for domain 1oktA02

Chopping figure for domain 1oktA02
DomainStart PDB ResidueStop PDB Residue
1oktA01 1 85
1oktA02 86 211

Structural Neighbourhood (16 entries)

There are 16 matching structural neighberhood comparisons for CATH ID 1.20.1050.10.13.1.1.2.3 (SIMAX score < 5)

[1]
Displaying entries 1 to 16 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2gsqA02 88.13 Ommastrephes sloaniGlutathione S-transferase 1.20.1050.10 108 21 87 2.19 2.50
1dugA02 87.98 Fibrinogen gamma chainGlutathione S-transferase class-mu 26 kDa isozymeExternal side of plasma membraneFibrinogen complexEukaryotic cell surface binding 1.20.1050.10 105 21 86 2.77 3.19
1eemA02 86.87 Glutathione S-transferase [EC:2.5.1.18]Drug metabolism - cytochrome P450Glutathione S-transferase omega-1Metabolism of xenobiotics by cytochrome P450Homo sapiens 1.20.1050.10 115 13 93 1.97 2.10
2pvqA02 86.45 Glutathione S-transferaseOchrobactrum anthropi 1.20.1050.10 104 14 84 2.37 2.81
2dsaA02 86.38 Glutathione S-transferase [EC:2.5.1.18]Metabolism of xenobiotics by cytochrome P450Glutathione S-transferaseGlutathione metabolismBurkholderia xenovorans LB400 1.20.1050.10 106 14 85 2.17 2.55
1n2aA02 85.91 Metabolism of xenobiotics by cytochrome P450Glutathione metabolismGlutathione S-transferase [EC:2.5.1.18]Glutathione S-transferaseEscherichia coli K-12 1.20.1050.10 106 14 85 2.24 2.63
3f6dB02 85.67 Anopheles dirusGlutathione transferase GST1-4 1.20.1050.10 123 10 88 2.47 2.79
1hqoA02 84.97 Soluble fractionCytosolProtein URE2Cytoplasmic sequestering of transcription factorProtein urmylation 1.20.1050.10 126 13 82 2.42 2.93
1aw9A02 84.26 Glutathione transferase III(A)Zea mays 1.20.1050.10 121 14 85 2.46 2.89
1v2aA02 84.13 Anopheles dirusGlutathione transferase gst1-6 1.20.1050.10 132 11 82 2.26 2.74
1gnwA02 84.11 Glutathione bindingMicrosomeChloroplast stromaPlasma membraneToxin catabolic process 1.20.1050.10 125 12 84 2.58 3.07
1gwcA02 83.15 Aegilops tauschiiGlutathione S-transferase 1 1.20.1050.10 141 14 80 2.44 3.04
1nhyA02 82.88 Positive regulation of transcription from RNA polymerase II promoterCalcium ion bindingNucleusElongation factor 1-gamma 1Transcription coactivator activity 1.20.1050.10 139 15 79 2.85 3.60
1k0oB02 81.19 Membrane fractionChloride intracellular channel protein 1Soluble fractionChloride transportSignal transduction 1.20.1050.10 123 14 80 2.91 3.62
2vo4A02 80.52 2,4-D inducible glutathione S-transferaseGlycine max 1.20.1050.10 132 13 80 3.22 4.01
2c3nA02 78.76 Soluble fractionGlutathione S-transferase theta-1Glutathione metabolic processGlutathione transferase activityGlutathione metabolism 1.20.1050.10 160 8 68 2.71 3.94
[1]
Displaying entries 1 to 16 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1oktA02
CGESELNEFYADMIFCGVQDIHYKFNNTNLFKQNETTFLNEDLPKWSGYFEKLLKKNHTNNNNDKYYFVGNNLTYADLAV
FNLYDDIETKYPSSLKNFPLLKAHNEFISNLPNIKNYITNRKESVY
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1oktA02
CGESELNEFYADMIFCGVQDIHYKFNNTNLFKQNETTFLNEDLPKWSGYFEKLLKKNHTNNNNDKYYFVGNNLTYADLAV
FNLYDDIETKYPSSLKNFPLLKAHNEFISNLPNIKNYITNRKESVY
BLAST against CATH

[top]
Domain History Events (3)

Insertion by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Flow stage update by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Insertion by auto on 05 Mar 2006 23:31

Cut based on decision in database "DomChop" on "cathdb"