CATH Domain: 1ohpA00 XML data for domain: 1ohpA00

Molscript image for 1ohpA00
1ohpA00
PDB coordinates for domain 1ohpA00

PDB 1ohp, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.450 Nuclear Transport Factor 2; Chain: A,
3.10.450.50 Gene3D
3.10.450.50.11
3.10.450.50.11.1
3.10.450.50.11.1.1
3.10.450.50.11.1.1.1
3.10.450.50.11.1.1.1.1

[top]
Segment boundaries for domain 1ohpA00

Chopping figure for domain 1ohpA00
DomainStart PDB ResidueStop PDB Residue
1ohpA00 1 125

Structural Neighbourhood (14 entries)

There are 14 matching structural neighberhood comparisons for CATH ID 3.10.450.50.11.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 14 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1tuhA00 86.67 Uncultured bacteriumPutative uncharacterized protein 3.10.450.50 131 20 93 3.00 3.20
1gy6A00 85.74 Nuclear transport factor 2Nuclear poreHomo sapiensProtein bindingCytosol 3.10.450.50 125 8 92 2.84 3.09
2rgqB00 85.42 3.10.450.50 124 8 89 3.23 3.60
3cnxA00 84.56 Streptomyces avermitilisPutative uncharacterized protein 3.10.450.50 135 13 85 2.82 3.28
3b7cA00 84.15 Shewanella oneidensisPutative uncharacterized protein 3.10.450.50 115 9 84 2.02 2.40
1jkgA00 83.71 CytoplasmNuclear poreHomo sapiensNTF2-related export protein 1 3.10.450.50 139 13 80 2.27 2.82
3dm8A00 83.62 Rhodopseudomonas palustrisPutative uncharacterized protein 3.10.450.50 131 16 89 3.07 3.44
2owpA00 82.83 Burkholderia xenovorans LB400Putative uncharacterized protein 3.10.450.50 124 16 86 2.99 3.46
3blzA00 82.53 Shewanella baltica OS155Putative uncharacterized protein 3.10.450.50 123 12 88 3.04 3.45
1of5B00 82.42 Nuclear poreNuclear RNA export factor complexMRNA transport regulator MTR2Ribosomal large subunit export from nucleusSaccharomyces cerevisiae 3.10.450.50 128 12 88 2.86 3.24
2ux0B00 81.38 Calcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiensCalcium- and calmodulin-dependent protein kinase complex 3.10.450.50 136 9 80 3.36 4.15
2r4iA00 81.05 Cytophaga hutchinsonii ATCC 33406Putative uncharacterized protein 3.10.450.50 113 12 85 3.34 3.90
3bb9B00 80.43 Putative orphan proteinShewanella frigidimarina NCIMB 400 3.10.450.50 120 10 89 3.84 4.29
2jq5A00 79.35 SEC-C motifSEC-C motif domain proteinRhodopseudomonas palustris 3.10.450.50 128 12 80 3.66 4.55
[1]
Displaying entries 1 to 14 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ohpA00
MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVENPVGSEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAF
AFIVSFEYQGRKTVVAPIDHFRFNGAGKVVSMRALFGEKNIHAGA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ohpA00
MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVENPVGSEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAF
AFIVSFEYQGRKTVVAPIDHFRFNGAGKVVSMRALFGEKNIHAGA
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 18:24

Assigning to "3.10.450.50" based on similarity with "1qjgB00" (NWSI: 100, NWO: 100, SPS: 97.64, SPO: 100, RMSD: 0.46)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1ohpA00"

Flow stage update by auto on 28 Apr 2006 17:43

All required files are present for Domain "1ohpA00"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1ohpA00"

Insertion by auto on 08 Mar 2006 22:03

Final ChopClose added based on similarity with "1qjgA" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 97.00, SI: 100, SO: 100]