CATH Domain: 1oh4A00 XML data for domain: 1oh4A00

Molscript image for 1oh4A00
1oh4A00
PDB coordinates for domain 1oh4A00

PDB 1oh4, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.60 Sandwich
2.60.120 Jelly Rolls
2.60.120.260 Galactose-binding domain-like Gene3D
2.60.120.260.3
2.60.120.260.3.1
2.60.120.260.3.1.1
2.60.120.260.3.1.1.1
2.60.120.260.3.1.1.1.1

[top]
Segment boundaries for domain 1oh4A00

Chopping figure for domain 1oh4A00
DomainStart PDB ResidueStop PDB Residue
1oh4A00 3 176

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 2.60.120.260.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3jxsA00 76.48 Rhodothermus marinusXylanase 2.60.120.260 166 9 83 4.10 4.92
1gnyA00 75.95 Cellvibrio japonicusEndo-beta-1,4-xylanase 2.60.120.260 153 9 79 3.78 4.77
1gu3A00 73.85 Cellulomonas fimiEndoglucanase C 2.60.120.260 142 15 71 3.44 4.79
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1oh4A00
ARYVLAEEVDFSSPEEVKNWWNSGTWQAEFGSPDIEWNGEVGNGALQLNVKLPGKSDWEEVRVARKFERLSECEILEYDI
YIPNVEGLKGRLRPYAVLNPGWVKIGLDMNNANVESAEIITFGGKEYRRFHVRIEFDRTAGVKELHIGVVGDHLRYDGPI
FIDNVRLYKRTGGM
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1oh4A00
MASNEARYVLAEEVDFSSPEEVKNWWNSGTWQAEFGSPDIEWNGEVGNGALQLNVKLPGKSDWEEVRVARKFERLSECEI
LEYDIYIPNVEGLKGRLRPYAVLNPGWVKIGLDMNNANVESAEIITFGGKEYRRFHVRIEFDRTAGVKELHIGVVGDHLR
YDGPIFIDNVRLYKRTGGM
BLAST against CATH

[top]
Domain History Events (5)

Classification merge by cuff on 26 Apr 2006 15:49

COMMENT: Ali - HMM overlap and SSAP scores good, but evalue poor. Tempted to say that these are two different types of jellyroll but am not 100% sure. FINAL: lesley - They all have the same topology. Merge H-levels based on SCOP assignment. Alison, trace the connectivity of the strands and tell me what you think about their topological relationship. ADAM-I am not happy with these HMM hits. I think there are alot missing. Can you look into this and possibly run all the H-levels in 2.60.120 against each other please!

Flow stage update by cuff on 26 Apr 2006 15:49

COMMENT: Ali - HMM overlap and SSAP scores good, but evalue poor. Tempted to say that these are two different types of jellyroll but am not 100% sure. FINAL: lesley - They all have the same topology. Merge H-levels based on SCOP assignment. Alison, trace the connectivity of the strands and tell me what you think about their topological relationship. ADAM-I am not happy with these HMM hits. I think there are alot missing. Can you look into this and possibly run all the H-levels in 2.60.120 against each other please!

Set cath from cathlist by auto on 05 Mar 2006 18:46

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:46

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:07

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"