CATH Domain: 1oh0B00 XML data for domain: 1oh0B00

Molscript image for 1oh0B00
1oh0B00
PDB coordinates for domain 1oh0B00

PDB 1oh0, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.450 Nuclear Transport Factor 2; Chain: A,
3.10.450.50 Gene3D
3.10.450.50.1
3.10.450.50.1.1
3.10.450.50.1.1.1
3.10.450.50.1.1.1.1
3.10.450.50.1.1.1.1.1

[top]
Segment boundaries for domain 1oh0B00

Chopping figure for domain 1oh0B00
DomainStart PDB ResidueStop PDB Residue
1oh0B00 203 330

Structural Neighbourhood (25 entries)

There are 25 matching structural neighberhood comparisons for CATH ID 3.10.450.50.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 25 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ohpA00 93.57 Comamonas testosteroniSteroid Delta-isomerase 3.10.450.50 125 32 97 1.27 1.30
1tuhA00 87.57 Uncultured bacteriumPutative uncharacterized protein 3.10.450.50 131 17 95 3.49 3.66
2imjD01 86.17 Hypothetical proteinPseudomonas fluorescens Pf-5Putative uncharacterized protein 3.10.450.50 140 15 83 1.96 2.35
1s5aA00 85.45 Bacillus subtilisUncharacterized protein yesE 3.10.450.50 135 14 91 3.24 3.56
3cnxA00 85.35 Streptomyces avermitilisPutative uncharacterized protein 3.10.450.50 135 13 85 2.69 3.13
1gy6A00 85.26 Nuclear transport factor 2Nuclear poreHomo sapiensProtein bindingCytosol 3.10.450.50 125 8 89 2.79 3.11
1nwwA00 84.59 Limonene-1,2-epoxide hydrolaseRhodococcus erythropolis 3.10.450.50 142 11 86 3.80 4.39
1z1sA00 84.27 Pseudomonas aeruginosaUncharacterized phzA/B-like protein PA3332 3.10.450.50 136 18 93 3.63 3.89
1jkgA00 84.11 CytoplasmNuclear poreHomo sapiensNTF2-related export protein 1 3.10.450.50 139 9 81 2.28 2.80
3dm8A00 84.07 Rhodopseudomonas palustrisPutative uncharacterized protein 3.10.450.50 131 10 90 3.58 3.97
1tp6A00 84.03 Pseudomonas aeruginosaPutative uncharacterized protein 3.10.450.50 126 7 85 2.23 2.59
2ux0B00 83.85 Calcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiensCalcium- and calmodulin-dependent protein kinase complex 3.10.450.50 136 12 83 3.13 3.73
1sjwA00 83.54 Streptomyces nogalaterNogalonic acid methyl ester cyclase 3.10.450.50 142 7 85 3.60 4.22
2owpA00 83.52 Burkholderia xenovorans LB400Putative uncharacterized protein 3.10.450.50 124 12 83 3.04 3.64
1of5B00 83.25 Nuclear poreNuclear RNA export factor complexMRNA transport regulator MTR2Ribosomal large subunit export from nucleusSaccharomyces cerevisiae 3.10.450.50 128 13 88 2.90 3.28
2rgqB00 83.09 3.10.450.50 124 11 89 3.80 4.23
3b8lA01 83.07 Novosphingobium aromaticivorans DSM 12444Putative uncharacterized protein 3.10.450.50 135 14 88 3.77 4.24
3b7cA00 82.73 Shewanella oneidensisPutative uncharacterized protein 3.10.450.50 115 10 84 2.57 3.05
3bb9B00 82.72 Putative orphan proteinShewanella frigidimarina NCIMB 400 3.10.450.50 120 5 86 3.21 3.70
3blzA00 81.67 Shewanella baltica OS155Putative uncharacterized protein 3.10.450.50 123 6 86 3.05 3.52
1idpA00 81.31 Scytalone dehydrataseMagnaporthe grisea 3.10.450.50 147 10 82 2.94 3.54
2r4iA00 81.29 Cytophaga hutchinsonii ATCC 33406Putative uncharacterized protein 3.10.450.50 113 5 84 2.95 3.50
1q42A00 78.47 MRNA transport regulator MTR2Candida albicans 3.10.450.50 159 13 76 3.72 4.89
2jq5A00 77.90 SEC-C motifSEC-C motif domain proteinRhodopseudomonas palustris 3.10.450.50 128 9 78 3.86 4.94
1vqqB01 77.82 Staphylococcus aureusPenicillin binding protein 2' 3.10.450.100 103 4 77 3.79 4.90
[1]
Displaying entries 1 to 25 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1oh0B00
LPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLGGGKVRACLTGPVRASHNGCG
AMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSVREP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1oh0B00
MNLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLGGGKVRACLTGPVRASHNG
CGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSVREPQ
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:53

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:53

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:17

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"