CATH Domain: 1oe8A02 XML data for domain: 1oe8A02

Molscript image for 1oe8A02
1oe8A02
PDB coordinates for domain 1oe8A02

PDB 1oe8, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1050 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2
1.20.1050.10 Gene3D
1.20.1050.10.12
1.20.1050.10.12.1
1.20.1050.10.12.1.1
1.20.1050.10.12.1.1.1
1.20.1050.10.12.1.1.1.1

[top]
Segment boundaries for domain 1oe8A02

Chopping figure for domain 1oe8A02
DomainStart PDB ResidueStop PDB Residue
1oe8A01 4 83
1oe8A02 84 207

Structural Neighbourhood (18 entries)

There are 18 matching structural neighberhood comparisons for CATH ID 1.20.1050.10.12.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 18 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3fr3B02 88.01 Glutathione S-transferase [EC:2.5.1.18]Metabolism of xenobiotics by cytochrome P450Glutathione S-transferaseGlutathione metabolismPlasmodium falciparum 1.20.1050.10 114 20 90 1.83 2.03
1dugA02 87.52 Fibrinogen gamma chainGlutathione S-transferase class-mu 26 kDa isozymeExternal side of plasma membraneFibrinogen complexEukaryotic cell surface binding 1.20.1050.10 105 21 84 1.93 2.28
1n2aA02 84.99 Metabolism of xenobiotics by cytochrome P450Glutathione metabolismGlutathione S-transferase [EC:2.5.1.18]Glutathione S-transferaseEscherichia coli K-12 1.20.1050.10 106 12 83 2.49 2.97
2gsqA02 84.77 Ommastrephes sloaniGlutathione S-transferase 1.20.1050.10 108 18 84 2.65 3.13
3f6dB02 84.72 Anopheles dirusGlutathione transferase GST1-4 1.20.1050.10 123 13 89 2.73 3.05
2pvqA02 84.51 Glutathione S-transferaseOchrobactrum anthropi 1.20.1050.10 104 17 83 2.88 3.43
1v2aA02 84.38 Anopheles dirusGlutathione transferase gst1-6 1.20.1050.10 132 14 85 2.46 2.87
2dsaA02 83.61 Glutathione S-transferase [EC:2.5.1.18]Metabolism of xenobiotics by cytochrome P450Glutathione S-transferaseGlutathione metabolismBurkholderia xenovorans LB400 1.20.1050.10 106 12 83 2.71 3.23
1eemA02 83.38 Glutathione S-transferase [EC:2.5.1.18]Drug metabolism - cytochrome P450Glutathione S-transferase omega-1Metabolism of xenobiotics by cytochrome P450Homo sapiens 1.20.1050.10 115 6 91 2.94 3.20
3cbuA02 82.75 Glutathione S-transferase [EC:2.5.1.18]Ralstonia eutropha JMP134Metabolism of xenobiotics by cytochrome P450Probable gst-related proteinGlutathione metabolism 1.20.1050.10 132 15 87 2.94 3.37
1gnwA02 82.19 Glutathione bindingMicrosomeChloroplast stromaPlasma membraneToxin catabolic process 1.20.1050.10 125 14 91 3.19 3.50
1nhyA02 82.07 Positive regulation of transcription from RNA polymerase II promoterCalcium ion bindingNucleusElongation factor 1-gamma 1Transcription coactivator activity 1.20.1050.10 139 13 82 3.27 3.95
1gwcA02 81.98 Aegilops tauschiiGlutathione S-transferase 1 1.20.1050.10 141 17 84 2.84 3.37
1k0oB02 81.88 Membrane fractionChloride intracellular channel protein 1Soluble fractionChloride transportSignal transduction 1.20.1050.10 123 13 84 3.41 4.03
1aw9A02 81.48 Glutathione transferase III(A)Zea mays 1.20.1050.10 121 14 90 3.80 4.21
1hqoA02 80.90 Soluble fractionCytosolProtein URE2Cytoplasmic sequestering of transcription factorProtein urmylation 1.20.1050.10 126 9 87 3.31 3.79
2c3nA02 79.45 Soluble fractionGlutathione S-transferase theta-1Glutathione metabolic processGlutathione transferase activityGlutathione metabolism 1.20.1050.10 160 12 75 3.06 4.08
2vo4A02 77.71 2,4-D inducible glutathione S-transferaseGlycine max 1.20.1050.10 132 9 84 3.71 4.41
[1]
Displaying entries 1 to 18 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1oe8A02
MMGGTEEEYYNVEKLIGQAEDLEHEYYKTLMKPEEEKQKIIKEILNGKVPVLLDIICESLKASTGKLAVGDKVTLADLVL
IAVIDHVTDLDKEFLTGKYPEIHKHRENLLASSPRLAKYLSDRA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1oe8A02
MMGGTEEEYYNVEKLIGQAEDLEHEYYKTLMKPEEEKQKIIKEILNGKVPVLLDIICESLKASTGKLAVGDKVTLADLVL
IAVIDHVTDLDKEFLTGKYPEIHKHRENLLASSPRLAKYLSDRAATPF
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:26

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"