CATH Domain: 1oc2A02 XML data for domain: 1oc2A02

Molscript image for 1oc2A02
1oc2A02
PDB coordinates for domain 1oc2A02

PDB 1oc2, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.25 UDP-galactose 4-epimerase; domain 1
3.90.25.10 UDP-galactose 4-epimerase, domain 1 Gene3D
3.90.25.10.14
3.90.25.10.14.1
3.90.25.10.14.1.1
3.90.25.10.14.1.1.1
3.90.25.10.14.1.1.1.1

[top]
Segment boundaries for domain 1oc2A02

Chopping figure for domain 1oc2A02
DomainStart PDB ResidueStop PDB Residue
1oc2A01 4 197
1oc2A01 225 258
1oc2A01 290 312
1oc2A02 198 224
1oc2A02 259 280
1oc2A02 313 340

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1oc2A02
IEKFIPRQITNILAGIKPKLYGEGKNVNNKEVLELILEKMGQPKDAYDHEGLEETIQWYTDNQDWWKAEKEAVEANY
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1oc2A02
IEKFIPRQITNILAGIKPKLYGEGKNVNNKEVLELILEKMGQPKDAYDHEGLEETIQWYTDNQDWWKAEKEAVEANY
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:32

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:32

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:26

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"