CATH Domain: 1oacA04 XML data for domain: 1oacA04

Molscript image for 1oacA04
1oacA04
PDB coordinates for domain 1oacA04

PDB 1oac, Chain A, Domain 4

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.450 Nuclear Transport Factor 2; Chain: A,
3.10.450.40 Gene3D
3.10.450.40.10
3.10.450.40.10.1
3.10.450.40.10.1.1
3.10.450.40.10.1.1.1
3.10.450.40.10.1.1.1.1

[top]
Segment boundaries for domain 1oacA04

Chopping figure for domain 1oacA04
DomainStart PDB ResidueStop PDB Residue
1oacA01 5 84
1oacA02 86 186
1oacA03 314 723
1oacA04 187 292

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.10.450.40.10.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ksiA02 88.09 Pisum sativumPrimary amine oxidase 3.10.450.40 96 21 89 1.61 1.80
1tu5B02 78.78 Tyrosine metabolismAmine metabolic processBos taurusCopper ion bindingPrimary-amine oxidase [EC:1.4.3.21] 3.10.450.40 122 18 76 3.09 4.05
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1oacA04
VLLDDFASVQNIINNSEEFAAAVKKRGITDAKKVITTPLTVGYFDGKDGLKQDARLLKVISYLDVGDGNYWAHPIENLVA
VVDLEQKKIVKIEEGPVVPVPMTARP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1oacA04
VLLDDFASVQNIINNSEEFAAAVKKRGITDAKKVITTPLTVGYFDGKDGLKQDARLLKVISYLDVGDGNYWAHPIENLVA
VVDLEQKKIVKIEEGPVVPVPMTARP
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:53

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:53

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:25

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"