CATH Domain: 1oacA02 XML data for domain: 1oacA02

Molscript image for 1oacA02
1oacA02
PDB coordinates for domain 1oacA02

PDB 1oac, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.450 Nuclear Transport Factor 2; Chain: A,
3.10.450.40 Gene3D
3.10.450.40.7
3.10.450.40.7.1
3.10.450.40.7.1.1
3.10.450.40.7.1.1.1
3.10.450.40.7.1.1.1.1

[top]
Segment boundaries for domain 1oacA02

Chopping figure for domain 1oacA02
DomainStart PDB ResidueStop PDB Residue
1oacA01 5 84
1oacA02 86 186
1oacA03 314 723
1oacA04 187 292

Structural Neighbourhood (9 entries)

There are 9 matching structural neighberhood comparisons for CATH ID 3.10.450.40.7.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 9 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ksiA01 87.66 Pisum sativumPrimary amine oxidase 3.10.450.40 96 22 94 2.58 2.74
1w6gA01 85.97 Phenylethylamine oxidaseArthrobacter globiformis 3.10.450.40 87 20 82 2.11 2.57
3hi7B01 83.65 Diamine oxidase [EC:1.4.3.22]Arginine and proline metabolismAmiloride-sensitive amine oxidase [copper-containing]Homo sapiensPrimary amine oxidase activity 3.10.450.40 110 14 83 2.87 3.43
1tu5A01 83.40 Tyrosine metabolismAmine metabolic processBos taurusCopper ion bindingPrimary-amine oxidase [EC:1.4.3.21] 3.10.450.40 108 15 83 2.84 3.41
2gu3A02 79.71 Uncharacterized protein ypmBBacillus subtilis 3.10.450.40 63 19 61 2.75 4.48
1ksiA02 79.50 Pisum sativumPrimary amine oxidase 3.10.450.40 96 12 75 3.17 4.21
2gu3A01 77.68 Uncharacterized protein ypmBBacillus subtilis 3.10.450.40 65 10 63 2.63 4.15
2ig7A01 75.78 Glycerophospholipid metabolismPhosphatidylethanolamine biosynthetic processEthanolamine kinase activityCholine kinase [EC:2.7.1.32]Choline/ethanolamine kinase 3.10.450.110 80 6 62 2.87 4.60
3fi8A01 74.57 Plasmodium falciparum 3D7Glycerophospholipid metabolismCholine kinaseCholine kinase [EC:2.7.1.32]Metabolic pathways 3.10.450.110 80 2 63 2.71 4.28
[1]
Displaying entries 1 to 9 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1oacA02
TFQVEKRPHPLNALTADEIKQAVEIVKASADFKPNTRFTEISLLPPDKEAVWAFALENKPVDQPRKADVIMLDGKHIIEA
VVDLQNNKLLSWQPIKDAHGM
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1oacA02
TFQVEKRPHPLNALTADEIKQAVEIVKASADFKPNTRFTEISLLPPDKEAVWAFALENKPVDQPRKADVIMLDGKHIIEA
VVDLQNNKLLSWQPIKDAHGM
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:53

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:53

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:25

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"