CATH Domain: 1o9rA00 XML data for domain: 1o9rA00

Molscript image for 1o9rA00
1o9rA00
PDB coordinates for domain 1o9rA00

PDB 1o9r, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1260 Ferritin;
1.20.1260.10 Gene3D
1.20.1260.10.3
1.20.1260.10.3.1
1.20.1260.10.3.1.1
1.20.1260.10.3.1.1.1
1.20.1260.10.3.1.1.1.1

[top]
Segment boundaries for domain 1o9rA00

Chopping figure for domain 1o9rA00
DomainStart PDB ResidueStop PDB Residue
1o9rA00 1 162

Structural Neighbourhood (18 entries)

There are 18 matching structural neighberhood comparisons for CATH ID 1.20.1260.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 18 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2yw6B00 91.46 Mycobacterium smegmatisDNA protection during starvation proteinStarvation-inducible DNA-binding protein 1.20.1260.10 150 30 92 1.16 1.25
2fjcB00 91.30 Treponema pallidumStarvation-inducible DNA-binding proteinAntigen TpF1 1.20.1260.10 156 24 96 2.74 2.85
1tjoB00 90.67 DNA protection during starvation proteinHalobacterium salinarum 1.20.1260.10 175 22 92 1.65 1.78
1jigA00 90.48 Bacillus anthracisStarvation-inducible DNA-binding proteinDNA protection during starvation protein 1 1.20.1260.10 146 24 90 1.39 1.54
2cf7A00 89.99 Streptococcus suisDNA protection during starvation proteinStarvation-inducible DNA-binding protein 1.20.1260.10 156 26 94 4.61 4.88
3fvbA00 88.78 BacterioferritinBrucella melitensis biovar Abortus 2308Bacterioferritin 1.20.1260.10 161 14 88 2.28 2.56
3kwoA00 87.52 DNA protection during starvation proteinCampylobacter jejuniStarvation-inducible DNA-binding proteinProtein binding 1.20.1260.10 144 25 88 2.20 2.48
1lkoA01 87.30 Desulfovibrio vulgaris str. HildenboroughIron ion bindingRubrerythrin 1.20.1260.10 145 11 86 2.85 3.30
2qqyA00 87.23 Bacillus anthracisBacterioferritinPutative uncharacterized protein 1.20.1260.10 133 15 82 2.03 2.47
1vlgA00 86.01 Porphyrin and chlorophyll metabolismThermotoga maritimaFerritin [EC:1.16.3.1]Ferritin 1.20.1260.10 164 11 87 3.00 3.42
2ib0A01 85.81 Mycobacterium tuberculosisCONSERVED HYPOTHETICAL ALANINE RICH PROTEIN 1.20.1260.10 135 11 83 2.47 2.96
3bvfA00 84.20 Ferritin [EC:1.16.3.1]FerritinPorphyrin and chlorophyll metabolismHelicobacter pylori J99 1.20.1260.10 157 7 82 3.04 3.68
3a9qE00 84.12 Ferritin-4, chloroplasticGlycine max 1.20.1260.10 168 7 85 3.38 3.97
3bt5A00 83.28 Deinococcus radioduransPutative uncharacterized protein 1.20.1260.10 148 6 84 2.89 3.42
2oh3A01 82.88 Magnetospirillum magneticum AMB-1Uncharacterized conserved protein 1.20.1260.10 132 11 79 2.95 3.73
2oc5A01 77.92 Prochlorococcus marinus str. MIT 9313Putative uncharacterized protein 1.20.1260.10 203 11 64 3.00 4.68
3csxA00 71.71 Cyanothece sp. ATCC 51142DUF683-containing protein 1.10.287.660 61 11 35 1.76 4.92
2rklB00 68.69 Multivesicular bodyVacuolar protein sorting-associated protein VTA1Membrane fractionProtein bindingEndocytosis 1.20.5.420 50 18 30 1.38 4.47
[1]
Displaying entries 1 to 18 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1o9rA00
MKTHKTKNDLPSNAKSTVIGILNESLASVIDLALVTKQAHWNLKGPQFIAVHELLDTFRTQLDNHGDTIAERVVQLGGTA
LGSLQAVSSTTKLKAYPTDIYKIHDHLDALIERYGEVANMIRKAIDDSDEAGDPTTADIFTAASRDLDKSLWFLEAHVQE
KS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1o9rA00
MKTHKTKNDLPSNAKSTVIGILNESLASVIDLALVTKQAHWNLKGPQFIAVHELLDTFRTQLDNHGDTIAERVVQLGGTA
LGSLQAVSSTTKLKAYPTDIYKIHDHLDALIERYGEVANMIRKAIDDSDEAGDPTTADIFTAASRDLDKSLWFLEAHVQE
KS
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:21

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:21

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:43

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"