Set cath from cathlist by auto on 05 Mar 2006 19:12
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1o9gA01 | 2 | 101 |
| 1o9gA01 | 145 | 250 |
| 1o9gA02 | 102 | 144 |
There are 16 matching structural neighberhood comparisons for CATH ID 3.40.50.150.7.1.1.1.1 (SIMAX score < 5)
>pdb|1o9gA01 SAYRHAVERDSSDLACGVVLHSAPGYPAFPVRLATEIFQRALARLPGDGPVTLWDPCCGSGYLLTVLGLLHRRSLRQVIA SDVDPAPLELAAKNLALLSLPCAIRTADVFDPRALSAVLAGSAPDVVLTDLPYGERTHWEGQVPGQPVAGLLRSLASALP AHAVIAVTDRSRKIPVAPVKALERLKIGTRSAVVRAADVLEAGP
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"