CATH Domain: 1o4sA02 XML data for domain: 1o4sA02

Molscript image for 1o4sA02
1o4sA02
PDB coordinates for domain 1o4sA02

PDB 1o4s, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.640 Aspartate Aminotransferase; domain 2
3.40.640.10 Type I PLP-dependent aspartate aminotransferase-like (Major domain) Gene3D
3.40.640.10.37
3.40.640.10.37.1
3.40.640.10.37.1.1
3.40.640.10.37.1.1.1
3.40.640.10.37.1.1.1.1

[top]
Segment boundaries for domain 1o4sA02

Chopping figure for domain 1o4sA02
DomainStart PDB ResidueStop PDB Residue
1o4sA01 2 60
1o4sA01 282 373
1o4sA02 61 281

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 3.40.640.10.37.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1xi9A02 89.48 Pyrococcus furiosusAminotransferase [EC:2.6.1.-]Alanine aminotransferase 3.40.640.10 242 34 90 1.59 1.76
3dydA02 87.90 Tyrosine metabolismL-tyrosine:2-oxoglutarate aminotransferase activityPhenylalanine metabolismMetabolic pathwaysUbiquinone and other terpenoid-quinone biosynthesis 3.40.640.10 244 23 89 1.74 1.95
3ffhB02 86.08 Tyrosine metabolismListeria innocuaHistidinol-phosphate aminotransferase [EC:2.6.1.9]Histidine metabolismMetabolic pathways 3.40.640.10 208 19 91 2.24 2.45
1d2fA02 85.84 Nitrogen metabolismSelenoamino acid metabolismSulfur metabolismMetabolic pathwaysCysteine and methionine metabolism 3.40.640.10 243 19 89 2.37 2.64
1uu1A02 85.54 Thermotoga maritimaTyrosine metabolismHistidinol-phosphate aminotransferase [EC:2.6.1.9]Histidine metabolismMetabolic pathways 3.40.640.10 203 27 88 2.22 2.52
3ftbA02 85.00 Tyrosine metabolismHistidinol-phosphate aminotransferase [EC:2.6.1.9]Histidine metabolismPhenylalanine metabolismMetabolic pathways 3.40.640.10 222 20 91 2.39 2.60
1m32A02 79.54 2-aminoethylphosphonate--pyruvate transaminaseSalmonella enterica subsp. enterica serovar Typhimurium2-aminoethylphosphonate-pyruvate transaminase [EC:2.6.1.37]Phosphonate and phosphinate metabolismMetabolic pathways 3.40.640.10 237 12 81 3.96 4.84
1qgnG01 78.90 Cystathionine gamma-synthaseNicotiana tabacum 3.40.640.10 259 11 75 3.03 4.00
[1]
Displaying entries 1 to 8 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1o4sA02
KYTDPRGIYELREGIAKRIGERYKKDISPDQVVVTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIPQIILAGGTVNVV
ETFMSKNFQPSLEEVEGLLVGKTKAVLINSPNNPTGVVYRREFLEGLVRLAKKRNFYIISDEVYDSLVYTDEFTSILDVS
EGFDRIVYINGFSKSHSMTGWRVGYLISSEKVATAVSKIQSHTTSCINTVAQYAALKALEV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1o4sA02
KYTDPRGIYELREGIAKRIGERYKKDISPDQVVVTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIPQIILAGGTVNVV
ETFMSKNFQPSLEEVEGLLVGKTKAVLINSPNNPTGVVYRREFLEGLVRLAKKRNFYIISDEVYDSLVYTDEFTSILDVS
EGFDRIVYINGFSKSHSMTGWRVGYLISSEKVATAVSKIQSHTTSCINTVAQYAALKALEV
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:28

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:28

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:24

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"