Set cath from cathlist by auto on 05 Mar 2006 18:20
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1o2dA01 | 7 | 179 |
| 1o2dA02 | 180 | 358 |
There are 1 matching structural neighberhood comparisons for CATH ID 1.20.1090.10.4.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1oj7A02 | 83.25 | 1.20.1090.10 | 204 | 20 | 84 | 3.06 | 3.63 |
>pdb|1o2dA02 DELTLSTGVDALSHAVEGYLSRKSTPPSDALAIEAKIIHRNLPKAIEGNREARKKFVASCLAGVIAQTGTTLAHALGYPL TTEKGIKHGKATGVLPFVEVKEEIPEKVDTVNHIFGGSLLKFLKELGLYEKVAVSSEELEKWVEKGSRAKHLKNTPGTFT PEKIRNIYREALG
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"