CATH Domain: 1o20A02 XML data for domain: 1o20A02

Molscript image for 1o20A02
1o20A02
PDB coordinates for domain 1o20A02

PDB 1o20, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.309 Aldehyde Dehydrogenase; Chain A, domain 2
3.40.309.10 Aldehyde Dehydrogenase; Chain A, domain 2 Gene3D
3.40.309.10.10
3.40.309.10.10.1
3.40.309.10.10.1.1
3.40.309.10.10.1.1.1
3.40.309.10.10.1.1.1.1

[top]
Segment boundaries for domain 1o20A02

Chopping figure for domain 1o20A02
DomainStart PDB ResidueStop PDB Residue
1o20A01 2 223
1o20A01 373 415
1o20A02 224 372

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.40.309.10.10.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3dloD00 76.57 Archaeoglobus fulgidusPutative uncharacterized protein 3.40.50.620 131 9 71 3.54 4.98
1q77A00 74.47 Uncharacterized protein aq_178Aquifex aeolicus 3.40.50.620 137 6 74 3.24 4.35
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1o20A02
VGNCHIFVDESADLKKAVPVIINAKTQRPGTCNAAEKLLVHEKIAKEFLPVIVEELRKHGVEVRGCEKTREIVPDVVPAT
EDDWPTEYLDLIIAIKVVKNVDEAIEHIKKYSTGHSESILTENYSNAKKFVSEIDAAAVYVNASTRFTD
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1o20A02
VGNCHIFVDESADLKKAVPVIINAKTQRPGTCNAAEKLLVHEKIAKEFLPVIVEELRKHGVEVRGCEKTREIVPDVVPAT
EDDWPTEYLDLIIAIKVVKNVDEAIEHIKKYSTGHSESILTENYSNAKKFVSEIDAAAVYVNASTRFTD
BLAST against CATH

[top]
Domain History Events (7)

Domain assigned by lewis on 09 Jan 2007 13:16

Assigning domain 1o20A02 to 3.40.309.10 (as agreed with the CATH update team) after the chain has been rechopped. The reason is that the domain is very similar to the old domain 1o20A03 (from the previous chopping at "Sun Mar 5 17:24:40 2006") which was in 3.40.309.10 at the time the chain was unchopped.

Flow stage update by auto on 01 Nov 2006 02:15

No satisfactory AssignClose result found.

Flow stage update by auto on 26 Oct 2006 06:42

No in_process hits for Domain "1o20A02" ready to be processed

Flow stage update by auto on 26 Oct 2006 06:42

NW result present for Domain "1o20A02"

Flow stage update by auto on 25 Oct 2006 13:29

All required files are present for Domain "1o20A02"

Flow stage update by auto on 25 Oct 2006 13:29

Beginning processing for Domain "1o20A02"

Insertion by dibley on 25 Oct 2006 11:38

Checked with Dr. Cuff