CATH Domain: 1o20A01 XML data for domain: 1o20A01

Molscript image for 1o20A01
1o20A01
PDB coordinates for domain 1o20A01

PDB 1o20, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.605 Aldehyde Dehydrogenase; Chain A, domain 1
3.40.605.10 Aldehyde Dehydrogenase; Chain A, domain 1 Gene3D
3.40.605.10.9
3.40.605.10.9.1
3.40.605.10.9.1.1
3.40.605.10.9.1.1.1
3.40.605.10.9.1.1.1.1

[top]
Segment boundaries for domain 1o20A01

Chopping figure for domain 1o20A01
DomainStart PDB ResidueStop PDB Residue
1o20A01 2 223
1o20A01 373 415
1o20A02 224 372

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.40.605.10.9.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1uxtA01 81.67 Thermoproteus tenaxGlyceraldehyde-3-phosphate dehydrogenase (NADP+) 3.40.605.10 273 9 82 3.59 4.34
1a4sA01 81.58 Betaine aldehyde dehydrogenaseGadus callarias 3.40.605.10 260 12 76 2.93 3.83
1t90A01 81.11 Methylmalonate semialdehyde dehydrogenase [acylating]Bacillus subtilisMethylmalonate-semialdehyde dehydrogenase [EC:1.2.1.27]Valine, leucine and isoleucine degradationPropanoate metabolism 3.40.605.10 280 14 83 4.07 4.89
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1o20A01
DELLEKAKKVREAWDVLRNATTREKNKAIKKIAEKLDERRKEILEANRIDVEKARERGVKESLVDRLALNDKRIDEIKAC
ETVIGLKDPVGEVIDSWVREDGLRIARVRVPIGPIGIIYESRPNVTVETTILALKSGNTILLRGGSDALNSNKAIVSAIR
EALKETEIPESSVEFIENTDRSLVLEIRLREYLSLVIPRGGYGLISFVRDNATVPVLETGGGQFGFGAEIGISTQRFHAR
GPVGLRELTTYKFVVLGEYHVRE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1o20A01
XGSDKIHHHHHHXDELLEKAKKVREAWDVLRNATTREKNKAIKKIAEKLDERRKEILEANRIDVEKARERGVKESLVDRL
ALNDKRIDEXIKACETVIGLKDPVGEVIDSWVREDGLRIARVRVPIGPIGIIYESRPNVTVETTILALKSGNTILLRGGS
DALNSNKAIVSAIREALKETEIPESSVEFIENTDRSLVLEXIRLREYLSLVIPRGGYGLISFVRDNATVPVLETGGGQFG
FGAEIGISTQRFHARGPVGLRELTTYKFVVLGEYHVRE
BLAST against CATH

[top]
Domain History Events (7)

Domain assigned by lewis on 19 Jan 2007 16:21

Assigning domain 1o20A01 to 3.40.605.10 (as agreed with the CATH update team) after the chain has been rechopped. The reason is that the domain is very similar to an old domain (from the previous chopping) which was in 3.40.605.10 at the time the chain was unchopped.

Flow stage update by auto on 01 Nov 2006 02:15

No satisfactory AssignClose result found.

Flow stage update by auto on 26 Oct 2006 06:42

No in_process hits for Domain "1o20A01" ready to be processed

Flow stage update by auto on 26 Oct 2006 06:42

NW result present for Domain "1o20A01"

Flow stage update by auto on 25 Oct 2006 13:29

All required files are present for Domain "1o20A01"

Flow stage update by auto on 25 Oct 2006 13:29

Beginning processing for Domain "1o20A01"

Insertion by dibley on 25 Oct 2006 11:38

Checked with Dr. Cuff