Set cath from cathlist by auto on 05 Mar 2006 19:25
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1o04A01 | 8 | 270 |
| 1o04A01 | 461 | 500 |
| 1o04A02 | 271 | 460 |
There are 8 matching structural neighberhood comparisons for CATH ID 3.40.309.10.2.1.1.1.1 (SIMAX score < 5)
>pdb|1o04A02 GKSPNIIMSDADMDWAVEQAHFALFFNQGQCSCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGPQVDETQF KKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAA VFTKDLDKANYLSQALQAGTVWVNCYDVFG
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"