Set cath from cathlist by auto on 05 Mar 2006 19:25
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1nytA01 | 1 | 101 |
| 1nytA01 | 245 | 258 |
| 1nytA02 | 102 | 244 |
There are 7 matching structural neighberhood comparisons for CATH ID 3.40.192.10.3.1.1.1.1 (SIMAX score < 5)
>pdb|1nytA01 METYAVFGNPIAHSKSPFIHQQFAQQLNIEHPYGRVLAPINDFINTLNAFFSAGGKGANVTVPFKEEAFARADELTERAA LAGAVNTLMRLEDGRLLGDNTAAHAFLLWHGVLPD
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"