CATH Domain: 1nxuA02 XML data for domain: 1nxuA02

Molscript image for 1nxuA02
1nxuA02
PDB coordinates for domain 1nxuA02

PDB 1nxu, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1370 Ribosomal Protein S8; Chain: A, domain 1
3.30.1370.60 Hypothetical oxidoreductase yiak; domain 2 Gene3D
3.30.1370.60.1
3.30.1370.60.1.1
3.30.1370.60.1.1.1
3.30.1370.60.1.1.1.2
3.30.1370.60.1.1.1.2.1

[top]
Segment boundaries for domain 1nxuA02

Chopping figure for domain 1nxuA02
DomainStart PDB ResidueStop PDB Residue
1nxuA01 2 64
1nxuA01 317 332
1nxuA02 65 164
1nxuA02 222 270
1nxuA03 181 220

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.1370.60.1.1.1.2.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2g8yA02 82.87 Uncharacterized oxidoreductase [EC:1.1.1.-]Uncharacterized oxidoreductase ybiCEscherichia coli K-12 3.30.1370.60 213 28 71 2.00 2.80
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1nxuA02
AQPKRITSLGAIEQWDAQRSIGNLTAKKDRAIELAADHGIGLVALRNANHWRGGSYGWQAAEKGYIGICWTNSIAVPPWG
AKECRIGTNPLIVAIPGYWKGSGSIVLDIATLLSDGASVAEVTQDNSDEYGISQIFIAIEVDK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1nxuA02
AQPKRITSLGAIEQWDAQRSIGNLTAKKXXDRAIELAADHGIGLVALRNANHWXRGGSYGWQAAEKGYIGICWTNSIAVX
PPWGAKECRIGTNPLIVAIPGYWKGSGXSIVLDXIATLLSDGASVAEVTQDNSDEYGISQIFIAIEVDK
BLAST against CATH

[top]
Domain History Events (3)

Insertion by sillitoe on 06 Mar 2006 15:33

HomCheck 'Assigned T' domains

Flow stage update by sillitoe on 06 Mar 2006 15:33

HomCheck 'Assigned T' domains

Insertion by auto on 05 Mar 2006 17:23

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"