Set cath from cathlist by auto on 05 Mar 2006 18:16
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1nxuA01 | 2 | 64 |
| 1nxuA01 | 317 | 332 |
| 1nxuA02 | 65 | 164 |
| 1nxuA02 | 222 | 270 |
| 1nxuA03 | 181 | 220 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1nxuA01 KVTFEQLKAAFNRVLISRGVDSETADACAEFARTTESGVYSHGVNRFPRFIQQLENGDIIPDNGITVDDSVWAKIQAL
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"