CATH Domain: 1nx8B00 XML data for domain: 1nx8B00

Molscript image for 1nx8B00
1nx8B00
PDB coordinates for domain 1nx8B00

PDB 1nx8, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.60 4-Layer Sandwich
3.60.130 Double-stranded beta-helix
3.60.130.10 Clavaminate synthase-like Gene3D
3.60.130.10.3
3.60.130.10.3.1
3.60.130.10.3.1.1
3.60.130.10.3.1.1.1
3.60.130.10.3.1.1.1.1

Segment boundaries for domain 1nx8B00

Chopping figure for domain 1nx8B00
DomainStart PDB ResidueStop PDB Residue
1nx8B00 2 272

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


Domain ATOM Sequence

>pdb|1nx8B00
SEIVKFNPVMASGFGAYIDHRDFLEAKTETIKNLLMRQGFVVVKNLDIDSDTFRDIYSAYGTIVEYAGVGFGYRDTLKLE
GEKGKIVTGRGQLPFHADGGLLLSQVDQVFLYAAEIKNVKFRGATTVCDHALACQEMPAHLLRVLEEETFEVRVLGWFKV
PVFTDLGWVRKMLIYFPFDEGQPASWEPRIVGFTDHETQAFFQELGAFLKQPRYYYKHFWEDGDLLIMDNRRVIHEREEF
NDDDIVRRLYRGQTAD    

Domain COMBS Sequence

>pdb|1nx8B00
MSEIVKFNPVMASGFGAYIDHRDFLEAKTETIKNLLMRQGFVVVKNLDIDSDTFRDIYSAYGTIVEYADEKIGVGFGYRD
TLKLEGEKGKIVTGRGQLPFHADGGLLLSQVDQVFLYAAEIKNVKFRGATTVCDHALACQEMPAHLLRVLEEETFEVRVL
ERGYYVDVSPDGWFKVPVFTDLGWVRKMLIYFPFDEGQPASWEPRIVGFTDHETQAFFQELGAFLKQPRYYYKHFWEDGD
LLIMDNRRVIHEREEFNDDDIVRRLYRGQTADI    

Domain History Events (13)

Domain assigned by auto on 17 Oct 2008 15:38

Assigning to "3.60.130.10" based on similarity with "1nx4A00"

Flow stage update by auto on 17 Oct 2008 15:33

No in_process hits for Domain "1nx8B00" ready to be processed

Update comment by auto on 17 Oct 2008 15:28

Domain "1nx8B00" hits Domain "1nx4A00" (97.8021978021978% over 100%) which is currently in process

Update comment by auto on 17 Oct 2008 15:13

Domain "1nx8B00" hits Domain "1nx4C00" (97.8021978021978% over 100%) which is currently in process

Update comment by auto on 23 Jul 2008 18:06

Domain "1nx8B00" hits Domain "1nx4B00" (97.8021978021978% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 20:12

Domain "1nx8B00" hits Domain "1nx4B00" (97.8021978021978% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:19

Domain "1nx8B00" hits Domain "1nx4B00" (97.8021978021978% over 100%) which is currently in process

Update comment by auto on 14 Aug 2007 22:44

Domain "1nx8B00" hits Domain "1nx4B00" (97.8021978021978% over 100%) which is currently in process

Flow stage update by auto on 14 Mar 2007 15:09

Domain "1nx8B00" hits Domain "1nx4B00" (97.8021978021978% over 100%) which is currently in process

Flow stage update by auto on 14 Mar 2007 15:06

NW result present for Domain "1nx8B00"

Flow stage update by auto on 14 Mar 2007 15:02

All required files are present for Domain "1nx8B00"

Flow stage update by auto on 14 Mar 2007 15:00

Beginning processing for Domain "1nx8B00"

Insertion by auto on 05 Mar 2006 16:05

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"