CATH Domain: 1nwwA00 XML data for domain: 1nwwA00

Molscript image for 1nwwA00
1nwwA00
PDB coordinates for domain 1nwwA00

PDB 1nww, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.450 Nuclear Transport Factor 2; Chain: A,
3.10.450.50 Gene3D
3.10.450.50.2
3.10.450.50.2.1
3.10.450.50.2.1.1
3.10.450.50.2.1.1.1
3.10.450.50.2.1.1.1.1

[top]
Segment boundaries for domain 1nwwA00

Chopping figure for domain 1nwwA00
DomainStart PDB ResidueStop PDB Residue
1nwwA00 5 149

Structural Neighbourhood (14 entries)

There are 14 matching structural neighberhood comparisons for CATH ID 3.10.450.50.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 14 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1s5aA00 84.99 Bacillus subtilisUncharacterized protein yesE 3.10.450.50 135 15 88 2.51 2.85
1ohpA00 84.61 Comamonas testosteroniSteroid Delta-isomerase 3.10.450.50 125 15 85 3.48 4.05
1tuhA00 84.43 Uncultured bacteriumPutative uncharacterized protein 3.10.450.50 131 16 86 3.15 3.64
3cnxA00 83.79 Streptomyces avermitilisPutative uncharacterized protein 3.10.450.50 135 10 81 3.64 4.46
3dm8A00 83.30 Rhodopseudomonas palustrisPutative uncharacterized protein 3.10.450.50 131 12 85 2.79 3.27
1gy6A00 83.17 Nuclear transport factor 2Nuclear poreHomo sapiensProtein bindingCytosol 3.10.450.50 125 9 80 3.60 4.45
3b8lA01 82.21 Novosphingobium aromaticivorans DSM 12444Putative uncharacterized protein 3.10.450.50 135 11 86 3.30 3.81
1tp6A00 81.64 Pseudomonas aeruginosaPutative uncharacterized protein 3.10.450.50 126 8 74 2.32 3.11
1sjwA00 81.63 Streptomyces nogalaterNogalonic acid methyl ester cyclase 3.10.450.50 142 15 88 3.59 4.08
3bb9B00 80.56 Putative orphan proteinShewanella frigidimarina NCIMB 400 3.10.450.50 120 12 77 2.84 3.67
1of5B00 79.56 Nuclear poreNuclear RNA export factor complexMRNA transport regulator MTR2Ribosomal large subunit export from nucleusSaccharomyces cerevisiae 3.10.450.50 128 7 77 3.28 4.23
3b7cA00 79.10 Shewanella oneidensisPutative uncharacterized protein 3.10.450.50 115 6 73 2.60 3.55
2r4iA00 78.76 Cytophaga hutchinsonii ATCC 33406Putative uncharacterized protein 3.10.450.50 113 7 75 2.83 3.76
1q42A00 76.58 MRNA transport regulator MTR2Candida albicans 3.10.450.50 159 8 75 3.53 4.68
[1]
Displaying entries 1 to 14 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1nwwA00
IEQPRWASKDSAAGAASTPDEKIVLEFMDALTSNDAAKLIEYFAEDTMYQNMPLPPAYGRDAVEQTLAGLFTVMSIDAVE
TFHIGSSNGLVYTERVDVLRALPTGKSYNLSILGVFQLTEGKITGWRDYFDLREFEEAVDLPLRG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1nwwA00
MTSKIEQPRWASKDSAAGAASTPDEKIVLEFMDALTSNDAAKLIEYFAEDTMYQNMPLPPAYGRDAVEQTLAGLFTVMSI
DAVETFHIGSSNGLVYTERVDVLRALPTGKSYNLSILGVFQLTEGKITGWRDYFDLREFEEAVDLPLRG
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:53

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:53

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:17

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"