Domain assigned by auto on 28 Apr 2006 18:17
Assigning to "1.10.8.10" based on similarity with "1nv8A01" (NWSI: 100, NWO: 100, SPS: 95.30, SPO: 95, RMSD: 0.63)
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1nv8B01 | 13 | 85 |
| 1nv8B02 | 86 | 281 |
There are 11 matching structural neighberhood comparisons for CATH ID 1.10.8.10.15.1.1.1.1 (SIMAX score < 5)
>pdb|1nv8B01 KIWSLIRDCSGKLEGVTETSVLEVLLIVSRVLGIRKEDLFLLGVSPTEEKRILELVEKRASGYPLHYILGE
Assigning to "1.10.8.10" based on similarity with "1nv8A01" (NWSI: 100, NWO: 100, SPS: 95.30, SPO: 95, RMSD: 0.63)
NW result present for Domain "1nv8B01"
All required files are present for Domain "1nv8B01"
Beginning processing for Domain "1nv8B01"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"