CATH Domain: 1ns5B00 XML data for domain: 1ns5B00

Molscript image for 1ns5B00
1ns5B00
PDB coordinates for domain 1ns5B00

PDB 1ns5, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.1280 Alpha/beta knot
3.40.1280.10 Gene3D
3.40.1280.10.3
3.40.1280.10.3.1
3.40.1280.10.3.1.1
3.40.1280.10.3.1.1.1
3.40.1280.10.3.1.1.1.1

[top]
Segment boundaries for domain 1ns5B00

Chopping figure for domain 1ns5B00
DomainStart PDB ResidueStop PDB Residue
1ns5B00 2 155

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.40.1280.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1vh0A00 91.27 Hypothetical proteinRibosomal RNA large subunit methyltransferase HStaphylococcus aureus 3.40.1280.10 157 32 94 1.77 1.88
1o6dA00 90.77 Hypothetical proteinThermotoga maritimaRibosomal RNA large subunit methyltransferase H 3.40.1280.10 147 25 94 1.62 1.71
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ns5B00
KLQLVAVGTKPDWVQTGFTEYLRRFPKDPFELIEIPAGKRGKNADIKRILDKEGEQLAAAGKNRIVTLDIPGKPWDTPQL
AAELERWKLDGRDVSLLIGGPEGLSPACKAAAEQSWSLSALTLPHPLVRVLVAESLYRAWSITTNHPYHRE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ns5B00
XKLQLVAVGTKXPDWVQTGFTEYLRRFPKDXPFELIEIPAGKRGKNADIKRILDKEGEQXLAAAGKNRIVTLDIPGKPWD
TPQLAAELERWKLDGRDVSLLIGGPEGLSPACKAAAEQSWSLSALTLPHPLVRVLVAESLYRAWSITTNHPYHRE
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:29

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:29

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:52

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"