Set cath from cathlist by auto on 05 Mar 2006 19:09
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1nrwA01 | 2 | 80 |
| 1nrwA01 | 211 | 285 |
| 1nrwA02 | 81 | 210 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1nrwA02 TIDKKRAYDILSWLESENYYYEVFTGSAIYTPQNGRELLDVELDRFRSANPEADLSVLKQAAEVQYSQSGFAYINSFQEL FEADEPIDFYNILGFSFFKEKLEAGWKRYEHAEDLTLVSSAEHNFELSSR
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"