CATH Domain: 1nrvA00 XML data for domain: 1nrvA00

Molscript image for 1nrvA00
1nrvA00
PDB coordinates for domain 1nrvA00

PDB 1nrv, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.505 SHC Adaptor Protein
3.30.505.10 SHC Adaptor Protein Gene3D
3.30.505.10.4
3.30.505.10.4.1
3.30.505.10.4.1.1
3.30.505.10.4.1.1.1
3.30.505.10.4.1.1.1.1

[top]
Segment boundaries for domain 1nrvA00

Chopping figure for domain 1nrvA00
DomainStart PDB ResidueStop PDB Residue
1nrvA00 429 533

Structural Neighbourhood (21 entries)

There are 21 matching structural neighberhood comparisons for CATH ID 3.30.505.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 21 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2oq1A03 93.08 T cell receptor complexZeta-chain (TCR) associated protein kinase [EC:2.7.10.2]Natural killer cell mediated cytotoxicityPositive thymic T cell selectionTyrosine-protein kinase ZAP-70 3.30.505.10 99 28 97 0.99 1.02
2oq1A01 91.99 T cell receptor complexZeta-chain (TCR) associated protein kinase [EC:2.7.10.2]Natural killer cell mediated cytotoxicityPositive thymic T cell selectionTyrosine-protein kinase ZAP-70 3.30.505.10 108 30 90 1.16 1.28
1opkA02 91.34 Protein domain specific bindingNucleusManganese ion bindingPeptidyl-tyrosine phosphorylationMus musculus 3.30.505.10 102 20 89 1.23 1.38
2shpA02 90.11 Tyrosine-protein phosphatase non-receptor type 11Homo sapiens 3.30.505.10 101 28 90 1.50 1.66
3c7iA00 89.56 Jak-STAT signaling pathwayNeurotrophin signaling pathwayNon-small cell lung cancerT cell receptor signaling pathwayErbB signaling pathway 3.30.505.10 101 26 93 2.34 2.51
1i3zA00 88.99 Mus musculusSH2 domain-containing protein 1BNegative regulation of natural killer cell mediated cytotoxicityNegative regulation of peptidyl-tyrosine phosphorylationPhosphotyrosine binding 3.30.505.10 102 25 94 1.99 2.11
2crhA01 88.85 Vav oncogeneChemokine signaling pathwayB cell receptor signaling pathwayLeukocyte transendothelial migrationFc gamma R-mediated phagocytosis 3.30.505.10 102 22 93 1.73 1.86
2dm0A01 88.67 Tyrosine-protein kinase TXKProtein phosphorylationTXK tyrosine kinase [EC:2.7.10.2]Leukocyte transendothelial migrationHomo sapiens 3.30.505.10 97 20 89 1.41 1.58
2iugA00 88.38 ErbB-3 class receptor bindingInsulin-like growth factor receptor signaling pathwayInsulin receptor signaling pathwayGrowth hormone receptor signaling pathwayInsulin-like growth factor receptor binding 3.30.505.10 110 25 88 2.06 2.34
1milA00 88.23 Transmembrane receptor protein tyrosine kinase adaptor activitySHC-transforming protein 1Regulation of epidermal growth factor receptor activityEpidermal growth factor receptor signaling pathwayInsulin-like growth factor receptor binding 3.30.505.10 104 22 90 1.86 2.06
1r1pB00 88.00 GRB2-related adaptor protein 2Mus musculusT cell receptor signaling pathwayProtein binding 3.30.505.10 100 24 90 2.37 2.63
1qadA00 87.97 Jak-STAT signaling pathwayAldosterone-regulated sodium reabsorptionNeurotrophin signaling pathwayNon-small cell lung cancerT cell receptor signaling pathway 3.30.505.10 104 22 90 2.42 2.68
1ayaA00 87.91 Hormone-mediated signaling pathwayRegulation of multicellular organism growthNerve growth factor receptor signaling pathwayTriglyceride metabolic processNegative regulation of insulin secretion 3.30.505.10 101 30 93 1.91 2.05
3bkbA01 86.37 Tyrosine-protein kinase Fes/FpsHomo sapiensCell proliferationMulticellular organismal development 3.30.505.10 93 24 87 3.08 3.54
2kk6A00 85.62 CytoplasmFer (fps/fes related) tyrosine kinase [EC:2.7.10.2]Homo sapiensAdherens junctionTyrosine-protein kinase Fer 3.30.505.10 116 24 81 1.59 1.96
1ju5A00 85.47 Pathways in cancerChemokine signaling pathwayNeurotrophin signaling pathwayFc gamma R-mediated phagocytosisErbB signaling pathway 3.30.505.10 109 23 82 2.03 2.46
2pldA00 84.91 Phosphatidylinositol signaling systemCalcium signaling pathwayPhospholipase C, gamma [EC:3.1.4.11]Pathways in cancerNeurotrophin signaling pathway 3.30.505.10 105 22 91 2.79 3.05
3buxB03 84.54 Jak-STAT signaling pathwayPathways in cancerT cell receptor signaling pathwayErbB signaling pathwayChronic myeloid leukemia 3.30.505.10 86 9 78 2.21 2.83
1rpyB00 84.30 SH2B adapter protein 2Nervous system developmentRattus norvegicusInsulin signaling pathwayNeurotrophin signaling pathway 3.30.505.10 85 22 78 3.63 4.65
2vifA01 83.84 CytoplasmJAK-STAT cascadeDefense responseSuppressor of cytokine signaling 6Suppressor of cytokine signaling 6 3.30.505.10 126 23 77 2.73 3.51
1bg1A04 75.18 Positive regulation of transcription from RNA polymerase II promoterTemperature homeostasisRegulation of multicellular organism growthNucleusPlasma membrane 3.30.505.10 109 14 69 3.22 4.62
[1]
Displaying entries 1 to 21 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1nrvA00
IHRTQHWFHGRISREESHRIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQKIKNFQILPCTFFSLDDGNTKFSDLIQLV
DFYQLNKGVLPCKLKHHCIR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1nrvA00
IHRTQHWFHGRISREESHRIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQKIKNFQILPCEDDGQTFFSLDDGNTKFSD
LIQLVDFYQLNKGVLPCKLKHHCIR
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:07

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:07

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:30

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"