CATH Domain: 1nrjA00 XML data for domain: 1nrjA00

Molscript image for 1nrjA00
1nrjA00
PDB coordinates for domain 1nrjA00

PDB 1nrj, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.450 Beta-Lactamase
3.30.450.60 Gene3D
3.30.450.60.1
3.30.450.60.1.1
3.30.450.60.1.1.1
3.30.450.60.1.1.1.1
3.30.450.60.1.1.1.1.1

[top]
Segment boundaries for domain 1nrjA00

Chopping figure for domain 1nrjA00
DomainStart PDB ResidueStop PDB Residue
1nrjA00 1 155

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.30.450.60.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2vglS00 79.55 Huntington's diseaseEndocytosisMus musculusAP-2 complex subunit sigmaAP-2 complex subunit sigma-1 3.30.450.60 142 8 75 3.02 4.00
2vglM01 78.96 Huntington's diseaseEndocytosisRattus norvegicusClathrin vesicle coatAP-2 complex subunit mu-1 3.30.450.60 141 7 73 2.81 3.82
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1nrjA00
MFDQLAVFTPQGQVLYQYNCLGKKFSEIQINSFISQLITSPVTRKESVANANTDGFDFNLLTINFNALFYLNKQPELYFV
VTFAEQTLELNQETQQTLALVLKLWNSLHLSESILKNRQGQNEKNKHNYVDILQGIEDDLKKFEQYF
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1nrjA00
MFDQLAVFTPQGQVLYQYNCLGKKFSEIQINSFISQLITSPVTRKESVANANTDGFDFNLLTINSEHKNSPSFNALFYLN
KQPELYFVVTFAEQTLELNQETQQTLALVLKLWNSLHLSESILKNRQGQNEKNKHNYVDILQGIEDDLKKFEQYFRIK
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:29

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"