Flow stage update by cuff on 25 Apr 2006 18:50
COMMENT: Sarah - Scores are quite good FINAL: Lesley - Yes, merge. Very good scores. Chopping looks fine. Move 1940 into 10940.
There are 2 matching structural neighberhood comparisons for CATH ID 3.40.50.10490.9.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
3i0zA02 | 76.28 | 3.40.50.10490 | 175 | 8 | 70 | 3.29 | 4.70 | |
![]() |
1moqA02 | 74.15 | 3.40.50.10490 | 148 | 10 | 58 | 2.79 | 4.78 |
>pdb|1nriA00 LSTLITEQRNPNSVDIDRQSTLEIVRLNEEDKLVPLAIESCLPQISLAVEQIVQAFQQGGRLIYIGAGTSGRLGVLDASE CPPTFGVSTEVKGIIAGGECAIRHPVEGAEDNTKAVLNDLQSIHFSKNDVLVGIAASGRTPYVIAGLQYAKSLGALTISI ASNPKSEAEIADIAIETIVGPEILTGSSRLKSGTAQKVLNLTTASILLGKCYENLVDVQASNEKLKARAVRIVQATDCNK
COMMENT: Sarah - Scores are quite good FINAL: Lesley - Yes, merge. Very good scores. Chopping looks fine. Move 1940 into 10940.
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"