Set cath from cathlist by auto on 05 Mar 2006 19:25
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1npyA01 | 1 | 100 |
| 1npyA02 | 101 | 269 |
There are 2 matching structural neighberhood comparisons for CATH ID 3.40.192.10.10.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1a4iA02 | 77.14 | 3.40.192.10 | 89 | 8 | 68 | 2.94 | 4.32 | |
![]() |
8abpA01 | 71.94 | 3.40.50.2300 | 138 | 11 | 54 | 2.69 | 4.95 |
>pdb|1npyA01 MINKDTQLCMSLSGRPSNFGTTFHNYLYDKLGLNFIYKAFTTQDIEHAIKGVRALGIRGCAVSMPFKETCMPFLDEIHPS AQAIESVNTIVNDNGFLRAY
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"