CATH Domain: 1no5B00 XML data for domain: 1no5B00

Molscript image for 1no5B00
1no5B00
PDB coordinates for domain 1no5B00

PDB 1no5, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.460 Beta Polymerase; domain 2
3.30.460.10 Beta Polymerase, domain 2 Gene3D
3.30.460.10.6
3.30.460.10.6.1
3.30.460.10.6.1.1
3.30.460.10.6.1.1.1
3.30.460.10.6.1.1.1.1

[top]
Segment boundaries for domain 1no5B00

Chopping figure for domain 1no5B00
DomainStart PDB ResidueStop PDB Residue
1no5B00 4 105

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.30.460.10.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1wotA00 82.48 Putative NucleotidyltransferaseThermus thermophilus 3.30.460.10 98 25 92 4.00 4.34
1ylqA00 78.58 Archaeoglobus fulgidusPutative uncharacterized protein 3.30.460.10 92 15 81 3.41 4.19
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1no5B00
FAQLDIKSEELAIVKTILQQLVPDYTVWAFGSRVKGKAKKYSDLDLAIISEEPLDFLARDRLKEAFSESDLPWRVDLLDW
ATTSEDFREIIRKVYVVIQEKE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1no5B00
MTSFAQLDIKSEELAIVKTILQQLVPDYTVWAFGSRVKGKAKKYSDLDLAIISEEPLDFLARDRLKEAFSESDLPWRVDL
LDWATTSEDFREIIRKVYVVIQEKEKTVEKPTAL
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 18:16

Assigning to "3.30.460.10" based on similarity with "1no5A00" (NWSI: 100, NWO: 100, SPS: 95.59, SPO: 98, RMSD: 0.66)

Flow stage update by auto on 28 Apr 2006 17:49

NW result present for Domain "1no5B00"

Flow stage update by auto on 28 Apr 2006 17:43

All required files are present for Domain "1no5B00"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1no5B00"

Insertion by auto on 08 Mar 2006 20:40

Final ChopClose added based on similarity with "1no5A" [LEE: 2, LME: 0, MR: 0, LG: 2, SS: 95.59, SI: 100, SO: 100]