Set cath from cathlist by auto on 05 Mar 2006 19:24
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1nnfA01 | 102 | 225 |
| 1nnfA01 | 278 | 308 |
| 1nnfA02 | 1 | 101 |
| 1nnfA02 | 226 | 277 |
There are 23 matching structural neighberhood comparisons for CATH ID 3.40.190.10.3.1.1.1.1 (SIMAX score < 5)
>pdb|1nnfA02 DITVYNGQQKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTATFADLSEAGLLAPISEQTIQ QTAQKGVPLAPKKDWIALSGRSYSGAAVLKASKNQAEAQKFVDFLASKKGQEALVAARAEYPLRADVVSPFNL
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"