Set cath from cathlist by auto on 05 Mar 2006 18:28
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1nn6A01 | 18 | 27 |
| 1nn6A01 | 123 | 228 |
| 1nn6A02 | 28 | 122 |
| 1nn6A02 | 229 | 240 |
There are 19 matching structural neighberhood comparisons for CATH ID 2.40.10.10.48.1.1.1.1 (SIMAX score < 5)
>pdb|1nn6A02 PYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIML LKLKEKASLTLAVGTHYRPWINQILQA
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"