Set cath from cathlist by auto on 05 Mar 2006 19:26
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1nm2A01 | 130 | 197 |
| 1nm2A02 | 1 | 129 |
| 1nm2A02 | 198 | 307 |
There are 1 matching structural neighberhood comparisons for CATH ID 3.40.366.10.3.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
2h1yA01 | 87.35 | 3.40.366.10 | 240 | 25 | 94 | 1.62 | 1.72 |
>pdb|1nm2A02 MLVLVAPGQGAQTPGFLTDWLALPGAADRVAAWSDAIGLDLAHFGTKADADEIRDTSVAQPLLVAAGILSAAALGTGFTP GAVAGHSVGEITAAVFAGVLDDTAALSLVRRRGLAMAEAGAFHTRHMAPAVDKLAEAAKALTPADPKVTYVSNKDGRAVA SGTEVLDRLVGQVANPVRWDLCMETFKELGVTAIIEVCPGGTLTGLAKRALPGVKTLALKTPDDLDAAR
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"