CATH Domain: 1nltA03 XML data for domain: 1nltA03

Molscript image for 1nltA03
1nltA03
PDB coordinates for domain 1nltA03

PDB 1nlt, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.60 Sandwich
2.60.260 HSP40/DNAj peptide-binding domain
2.60.260.20 Urease metallochaperone UreE, N-terminal domain Gene3D
2.60.260.20.3
2.60.260.20.3.1
2.60.260.20.3.1.1
2.60.260.20.3.1.1.2
2.60.260.20.3.1.1.2.1

[top]
Segment boundaries for domain 1nltA03

Chopping figure for domain 1nltA03
DomainStart PDB ResidueStop PDB Residue
1nltA01 110 142
1nltA01 209 255
1nltA02 143 208
1nltA03 256 337

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 2.60.260.20.3.1.1.2.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1c3gA02 90.20 Identical protein bindingProtein SIS1Saccharomyces cerevisiaeTranslational initiationCytosolic small ribosomal subunit 2.60.260.20 81 32 88 1.39 1.56
1nltA01 85.53 Identical protein binding'de novo' protein foldingMicrosomeDnaJ homolog subfamily A member 2Protein targeting to mitochondrion 2.60.260.20 80 18 85 3.67 4.32
1c3gA01 84.94 Identical protein bindingProtein SIS1Saccharomyces cerevisiaeTranslational initiationCytosolic small ribosomal subunit 2.60.260.20 78 9 82 2.13 2.60
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1nltA03
HKSFKRDGDDLVYEAEIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPIPKYGGYGNLIIKFTIKD
PE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1nltA03
HKSFKRDGDDLVYEAEIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPIPKYGGYGNLIIKFTIKD
PENHFTSEENLKKLE
BLAST against CATH

[top]
Domain History Events (5)

Classification merge by cuff on 26 Apr 2006 13:32

COMMENT: Ali - both chapones .. SCOP suggests they belong to same superfamily. superposition OK and suggests very similar topology. I would suggest merging at the H level FINAL: Lesley - Fine. Merge based on SCOP. e-values are marginal. Move 10 to 20.

Flow stage update by cuff on 26 Apr 2006 13:32

COMMENT: Ali - both chapones .. SCOP suggests they belong to same superfamily. superposition OK and suggests very similar topology. I would suggest merging at the H level FINAL: Lesley - Fine. Merge based on SCOP. e-values are marginal. Move 10 to 20.

Insertion by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Flow stage update by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Insertion by auto on 05 Mar 2006 23:29

Cut based on decision in database "DomChop" on "cathdb"