Set cath from cathlist by auto on 05 Mar 2006 19:07
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1ni9A01 | -1 | 109 |
| 1ni9A01 | 277 | 326 |
| 1ni9A02 | 110 | 276 |
There are 1 matching structural neighberhood comparisons for CATH ID 3.30.540.10.7.1.1.3.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1lbvA01 | 82.47 | 3.30.540.10 | 138 | 15 | 77 | 2.68 | 3.45 |
>pdb|1ni9A01 GHMRRELAIEFSRVTESAALAGYKWLGRGDKNTADGAAVNAMRIMLNQVNIDGTIVIGEGEAPMLYIGEKVGTGRGDAVD IAVDPIEGTQANALAVLAVGDKNVIFSATGITKGDLLEGISRKGNIATTETLLIRGKSRTIRRIQSIHYLDR
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"