CATH Domain: 1nhpA03 XML data for domain: 1nhpA03

Molscript image for 1nhpA03
1nhpA03
PDB coordinates for domain 1nhpA03

PDB 1nhp, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.390 Enolase-like; domain 1
3.30.390.30 Gene3D
3.30.390.30.5
3.30.390.30.5.1
3.30.390.30.5.1.1
3.30.390.30.5.1.1.1
3.30.390.30.5.1.1.1.1

[top]
Segment boundaries for domain 1nhpA03

Chopping figure for domain 1nhpA03
DomainStart PDB ResidueStop PDB Residue
1nhpA01 1 33
1nhpA01 60 112
1nhpA01 246 326
1nhpA02 41 58
1nhpA02 113 244
1nhpA03 334 446

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.30.390.30.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ebdA03 87.98 Dihydrolipoyl dehydrogenaseGeobacillus stearothermophilus 3.30.390.30 115 25 91 2.51 2.75
1xdiA03 85.24 Citrate cycle (TCA cycle)Valine, leucine and isoleucine degradationPyruvate metabolismGlycine, serine and threonine metabolismMetabolic pathways 3.30.390.30 122 13 86 2.87 3.30
2a8xA03 85.13 Citrate cycle (TCA cycle)Pyruvate metabolismValine, leucine and isoleucine degradationGlycine, serine and threonine metabolismMetabolic pathways 3.30.390.30 119 17 89 2.85 3.17
2nvkX03 83.13 Protein homodimerization activityThioredoxin reductase 1, mitochondrialDetermination of adult lifespanThioredoxin-disulfide reductase activityGlutathione-disulfide reductase activity 3.30.390.30 115 15 87 2.85 3.25
1mo9A03 78.24 2-oxopropyl-CoM reductase, carboxylatingXanthobacter autotrophicus Py2 3.30.390.30 153 16 67 2.94 4.37
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1nhpA03
YKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMT
IEDLAYADFFFQPAFDKPWNIINTAALEAVKQE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1nhpA03
YKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMT
IEDLAYADFFFQPAFDKPWNIINTAALEAVKQE
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1nhp003" to "1nhpA03" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 19:04

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:04

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:21

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"