CATH Domain: 1nheC00 XML data for domain: 1nheC00

Molscript image for 1nheC00
1nheC00
PDB coordinates for domain 1nheC00

PDB 1nhe, Chain C, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.530 Lysozyme
1.10.530.10 Gene3D
1.10.530.10.2
1.10.530.10.2.2
1.10.530.10.2.2.1
1.10.530.10.2.2.1.1
1.10.530.10.2.2.1.1.24

[top]
Segment boundaries for domain 1nheC00

Chopping figure for domain 1nheC00
DomainStart PDB ResidueStop PDB Residue
1nheC00 1 123

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.10.530.10.2.2.1.1.24 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3cb7A00 89.07 Lys-rich lysozyme 2Musca domestica 1.10.530.10 126 30 92 2.25 2.44
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1nheC00
TELTKCKVSHAIKDIDGYQGISLLEWACVLFHTSGYDTQAVVNDNGSTEYGLFQISDRFWCKSSEFPESENICGISCDKL
LDDELDDDIACAKKILAIKGIDYWKAYKPMCSEKLEQWRCEKP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1nheC00
TELTKCKVSHAIKDIDGYQGISLLEWACVLFHTSGYDTQAVVNDNGSTEYGLFQISDRFWCKSSEFPESENICGISCDKL
LDDELDDDIACAKKILAIKGIDYWKAYKPMCSEKLEQWRCEKP
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:12

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:12

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:32

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"