CATH Domain: 1ngnA00 XML data for domain: 1ngnA00

Molscript image for 1ngnA00
1ngnA00
PDB coordinates for domain 1ngnA00

PDB 1ngn, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.340 Endonuclease III; domain 1
1.10.340.30 Hypothetical protein; domain 2 Gene3D
1.10.340.30.9
1.10.340.30.9.1
1.10.340.30.9.1.1
1.10.340.30.9.1.1.1
1.10.340.30.9.1.1.1.1

[top]
Segment boundaries for domain 1ngnA00

Chopping figure for domain 1ngnA00
DomainStart PDB ResidueStop PDB Residue
1ngnA00 411 554

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1ngnA00
KWTPPRSPFNLVQEILFHDPWKLLIATIFLNRTSGKMAIPVLWEFLEKYPSAEVARAADWRDVSELLKPLGLYDLRAKTI
IKFSDEYLTKQWRYPIELHGIGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENHEKLSLS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ngnA00
ALSPPRRKSFKKWTPPRSPFNLVQEILFHDPWKLLIATIFLNRTSGKMAIPVLWEFLEKYPSAEVARAADWRDVSELLKP
LGLYDLRAKTIIKFSDEYLTKQWRYPIELHGIGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENHEKLSLS
BLAST against CATH

[top]
Domain History Events (5)

Classification merge by cuff on 25 Apr 2006 18:16

COMMENT: Mark - Clearly a homology missed during Homcheck FINAL: Lesley - Yes, clearly related. Mark, why were these not picked up during homolcheck???Lesley - Conservatively, Merge 10 into 30 for now, until better HMM hits allow us to clearly bring it into 10. They have strong functional correlations but the HMM hits are no present to any previously existing members of 10. Only a new one going into 10 and that call now being reconsidered in light of these X-hits.

Flow stage update by cuff on 25 Apr 2006 18:16

COMMENT: Mark - Clearly a homology missed during Homcheck FINAL: Lesley - Yes, clearly related. Mark, why were these not picked up during homolcheck???Lesley - Conservatively, Merge 10 into 30 for now, until better HMM hits allow us to clearly bring it into 10. They have strong functional correlations but the HMM hits are no present to any previously existing members of 10. Only a new one going into 10 and that call now being reconsidered in light of these X-hits.

Set cath from cathlist by auto on 05 Mar 2006 18:08

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:08

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:27

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"