CATH Domain: 1nfvA00 XML data for domain: 1nfvA00

Molscript image for 1nfvA00
1nfvA00
PDB coordinates for domain 1nfvA00

PDB 1nfv, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1260 Ferritin;
1.20.1260.10 Gene3D
1.20.1260.10.13
1.20.1260.10.13.1
1.20.1260.10.13.1.1
1.20.1260.10.13.1.1.1
1.20.1260.10.13.1.1.1.1

[top]
Segment boundaries for domain 1nfvA00

Chopping figure for domain 1nfvA00
DomainStart PDB ResidueStop PDB Residue
1nfvA00 4 172

Structural Neighbourhood (9 entries)

There are 9 matching structural neighberhood comparisons for CATH ID 1.20.1260.10.13.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 9 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2fjcB00 87.84 Treponema pallidumStarvation-inducible DNA-binding proteinAntigen TpF1 1.20.1260.10 156 12 84 2.31 2.75
2qqyA00 87.25 Bacillus anthracisBacterioferritinPutative uncharacterized protein 1.20.1260.10 133 24 78 2.04 2.61
2yw6B00 87.20 Mycobacterium smegmatisDNA protection during starvation proteinStarvation-inducible DNA-binding protein 1.20.1260.10 150 12 83 2.22 2.66
2ib0A01 86.44 Mycobacterium tuberculosisCONSERVED HYPOTHETICAL ALANINE RICH PROTEIN 1.20.1260.10 135 8 78 2.32 2.95
1jkvA01 84.41 Lactobacillus plantarumManganese catalase 1.20.1260.10 197 10 72 3.06 4.22
2oh3A01 83.16 Magnetospirillum magneticum AMB-1Uncharacterized conserved protein 1.20.1260.10 132 14 73 2.94 3.97
2qf9A01 81.59 Putative secreted proteinStreptomyces coelicolor 1.20.1260.10 140 7 72 3.16 4.34
1skvA00 71.01 Protein D-63Sulfolobus virus 1 1.10.287.660 62 11 30 1.14 3.78
2rklB00 69.37 Multivesicular bodyVacuolar protein sorting-associated protein VTA1Membrane fractionProtein bindingEndocytosis 1.20.5.420 50 16 29 1.31 4.43
[1]
Displaying entries 1 to 9 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1nfvA00
NREDRKAKVIEVLNKARAMELHAIHQYMNQHYSLDDMDYGELAANMKLIAIDEMRHAENFAERIKELGGEPTTQKEGKVV
TGQAVPVIYESDADQEDATIEAYSQFLKVCKEQGDIVTARLFERIIEEEQAHLTYYENIGSHIKNLGDTYLAKIAGTPSS
TGTASKGFV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1nfvA00
MAGNREDRKAKVIEVLNKARAMELHAIHQYMNQHYSLDDMDYGELAANMKLIAIDEMRHAENFAERIKELGGEPTTQKEG
KVVTGQAVPVIYESDADQEDATIEAYSQFLKVCKEQGDIVTARLFERIIEEEQAHLTYYENIGSHIKNLGDTYLAKIAGT
PSSTGTASKGFVTATPAAE
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:21

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:21

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:43

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"