CATH Domain: 1nf2A02 XML data for domain: 1nf2A02

Molscript image for 1nf2A02
1nf2A02
PDB coordinates for domain 1nf2A02

PDB 1nf2, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1240 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2
3.30.1240.10 Gene3D
3.30.1240.10.4
3.30.1240.10.4.1
3.30.1240.10.4.1.1
3.30.1240.10.4.1.1.1
3.30.1240.10.4.1.1.1.1

[top]
Segment boundaries for domain 1nf2A02

Chopping figure for domain 1nf2A02
DomainStart PDB ResidueStop PDB Residue
1nf2A01 1 81
1nf2A01 188 267
1nf2A02 82 187

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.30.1240.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1nrwA02 81.76 Bacillus subtilisUncharacterized phosphatase ywpJ 3.30.1240.10 130 13 80 2.76 3.45
1wqgA02 75.11 Ribosome recycling factorMycobacterium tuberculosisRibosome-recycling factor 3.30.1360.40 75 2 55 2.63 4.73
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1nf2A02
KIPPEVAKDIIEYIKPLNVHWQAYIDDVLYSEKDNEEIKSYARHSNVDYRVEPNLSELVSKMGTTKLLLIDTPERLDELK
EILSERFKDVVKVFKSFPTYLEIVPK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1nf2A02
KIPPEVAKDIIEYIKPLNVHWQAYIDDVLYSEKDNEEIKSYARHSNVDYRVEPNLSELVSKMGTTKLLLIDTPERLDELK
EILSERFKDVVKVFKSFPTYLEIVPK
BLAST against CATH

[top]
Domain History Events (3)

Insertion by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Flow stage update by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Insertion by auto on 05 Mar 2006 23:29

Cut based on decision in database "DomChop" on "cathdb"