CATH Domain: 1ne9A02

There are 38 matching structural neighberhood comparisons for CATH ID 3.40.630.30.13.1.1.1.2 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	1lrzA02	82.91	Peptidoglycan biosynthesisMetabolic pathwaysPeptidoglycan pentaglycine glycine transferase (the second and third glycine) [EC:2.3.2.-]Aminoacyltransferase femAStaphylococcus aureus	3.40.630.30	195	21	76	2.47	3.21
	2hqyA02	81.45	Hypothetical proteinBacteroides thetaiotaomicronPutative uncharacterized protein	3.40.630.30	164	9	89	2.82	3.14
	2fe7A00	80.93	Pseudomonas aeruginosaProbable N-acetyltransferase	3.40.630.30	154	7	76	3.00	3.93
	1s3zA00	80.65	Salmonella enterica subsp. enterica serovar EnteritidisAminoglycoside 6'-N-acetyltransferase	3.40.630.30	147	7	75	2.53	3.34
	1tiqB00	80.14	Bacillus subtilisProtease synthase and sporulation negative regulatory protein PAI 1	3.40.630.30	161	8	75	3.01	4.01
	2r7hB00	79.84	Desulfovibrio desulfuricans subsp. desulfuricans str. G20Putative uncharacterized protein	3.40.630.30	157	5	79	3.61	4.55
	3k9uA00	79.59	Putative uncharacterized protein Ta0374Thermoplasma acidophilum	3.40.630.30	159	6	78	3.06	3.88
	1q2yA00	79.54	Bacillus subtilisUncharacterized N-acetyltransferase yjcF	3.40.630.30	140	7	72	2.82	3.91
	1qsmD00	79.52	CytoplasmIdentical protein bindingSaccharomyces cerevisiaeHistone acetyltransferase activityHistone acetyltransferase HPA2	3.40.630.30	152	9	79	3.04	3.83
	3efaA00	78.91	Tyrosine metabolismBenzoate degradation via CoA ligationLactobacillus plantarumAcetyltransferase (Putative)Limonene and pinene degradation	3.40.630.30	141	7	71	2.82	3.94
	2r1iA01	78.81	Arthrobacter sp. FB24GCN5-related N-acetyltransferase	3.40.630.30	129	5	73	2.79	3.80
	2fiaA00	78.56	Acetyltransferase, GNAT familyEnterococcus faecalis	3.40.630.30	157	8	74	3.40	4.56
	2hv2A03	78.42	Enterococcus faecalisPutative uncharacterized protein	3.40.630.30	148	8	83	3.98	4.76
	2q7bA00	78.18	Acetyltransferase, GNAT familyStreptococcus agalactiae serogroup V	3.40.630.30	161	6	78	3.37	4.28
	2dxqA00	78.14	Agrobacterium tumefaciens str. C58Acetyltransferase	3.40.630.30	145	11	75	3.56	4.74
	3g8wA00	78.10	Staphylococcus epidermidis ATCC 12228Lactococcal prophage ps3 protein 05	3.40.630.30	158	12	75	3.32	4.38
	2i79D00	78.06	Acetyltransferase, GNAT familyStreptococcus pneumoniae	3.40.630.30	167	5	76	3.00	3.91
	1xebA00	78.01	Pseudomonas aeruginosaElaA proteinPutative uncharacterized protein	3.40.630.30	146	10	72	2.64	3.66
	3exnA00	77.98	Tyrosine metabolismLimonene and pinene degradation1- and 2-Methylnaphthalene degradationPhenylalanine metabolismBenzoate degradation via CoA ligation	3.40.630.30	151	3	78	3.46	4.43
	2ozgA01	77.84	Anabaena variabilis ATCC 29413GCN5-related N-acetyltransferase	3.40.630.30	117	10	67	2.62	3.89
	3fb3A00	77.69	Amino sugar and nucleotide sugar metabolismGlucosamine-phosphate N-acetyltransferase [EC:2.3.1.4]N-acetyltransferase, putativeTrypanosoma brucei	3.40.630.30	141	5	72	3.08	4.24
	3d8pB00	77.64	Staphylococcus aureus subsp. aureus Mu50Putative uncharacterized protein	3.40.630.30	157	8	76	3.28	4.26
	2fiwA00	77.50	Putative acetyltransferase [EC:2.3.1.-]GCN5-related N-acetyltransferase:Aminotransferase, class-IIRhodopseudomonas palustris	3.40.630.30	156	4	73	3.20	4.36
	3d3sA00	77.16	L-2,4-diaminobutyric acid acetyltransferaseGlycine, serine and threonine metabolismBordetella parapertussisL-2,4-diaminobutyric acid acetyltransferase [EC:2.3.1.178]Metabolic pathways	3.40.630.30	157	3	73	3.13	4.23
	3e0kA00	76.98	Arginine and proline metabolismVibrio parahaemolyticusAmino-acid N-acetyltransferase [EC:2.3.1.1]Amino-acid acetyltransferaseMetabolic pathways	3.40.630.30	143	6	67	2.67	3.93
	2pdoA01	76.95	Shigella flexneriAcetyltransferase ypeA	3.40.630.30	118	11	70	2.71	3.82
	1vhsB00	76.80	Bacillus subtilisPhosphinothricin acetyltransferase [EC:2.3.1.183]Phosphonate and phosphinate metabolismPutative phosphinothricin acetyltransferase ywnH	3.40.630.30	155	5	73	2.94	3.98
	2i00C01	76.77	Acetyltransferase, GNAT familyEnterococcus faecalis	3.40.630.30	144	6	69	2.68	3.85
	2qecA00	76.43	Corynebacterium glutamicumGCN5-related N-acetyltransferase	3.40.630.30	175	5	67	2.73	4.05
	2atrA00	75.93	Acetyltransferase, GNAT familyStreptococcus pneumoniae	3.40.630.30	127	6	67	2.93	4.32
	3ey5A01	75.87	Acetyltransferase-like, GNAT familyBacteroides thetaiotaomicron	3.40.630.30	144	2	70	3.23	4.59
	2ge3B00	75.79	Agrobacterium tumefaciens str. C58Probable acetyltransferase	3.40.630.30	159	7	75	3.76	4.96
	1y7rA00	75.42	Staphylococcus aureus subsp. aureus Mu50Putative uncharacterized protein	3.40.630.30	125	5	68	3.21	4.69
	2q0yA01	75.32	Ralstonia eutropha JMP134GCN5-related N-acetyltransferase	3.40.630.30	125	7	69	3.44	4.98
	1ro5A01	75.11	Pseudomonas aeruginosaAcyl homoserine lactone synthase [EC:2.3.1.184]Acyl-homoserine-lactone synthase	3.40.630.30	187	6	65	3.19	4.89
	1sqhA02	75.09	Drosophila melanogasterCG14615	3.40.630.30	128	7	73	3.38	4.57
	3eo4A00	74.45	Methanocaldococcus jannaschiiUncharacterized protein MJ1062	3.40.630.30	155	3	76	3.81	4.99
	2ozhA01	74.01	Xanthomonas campestris pv. campestrisPutative uncharacterized protein	3.40.630.30	120	11	68	3.41	4.98

>pdb|1ne9A02
MVLDLTKFPDAKTTLDLYPSKTKSKIKRPFRDGVEVHSGNSATELDEFFKTYTTMAERHGITHRPIEYFQRMQAAFDADT
MRIFVAEREGKLLSTGIALKYGRKIWYMYAGSMDGNTYYAPYAVQSEMIQWALDTNTDLYDLGGIESESTDDSLYVFKHV
FVKDA    

>pdb|1ne9A02
MVLDLTKFPDAKTTLDLYPSKTKSKIKRPFRDGVEVHSGNSATELDEFFKTYTTMAERHGITHRPIEYFQRMQAAFDADT
MRIFVAEREGKLLSTGIALKYGRKIWYMYAGSMDGNTYYAPYAVQSEMIQWALDTNTDLYDLGGIESESTDDSLYVFKHV
FVKDA