CATH Domain: 1nd4A02 XML data for domain: 1nd4A02

Molscript image for 1nd4A02
1nd4A02
PDB coordinates for domain 1nd4A02

PDB 1nd4, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.1200 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2
3.90.1200.10 Gene3D
3.90.1200.10.8
3.90.1200.10.8.1
3.90.1200.10.8.1.1
3.90.1200.10.8.1.1.1
3.90.1200.10.8.1.1.1.1

Segment boundaries for domain 1nd4A02

Chopping figure for domain 1nd4A02
DomainStart PDB ResidueStop PDB Residue
1nd4A01 10 95
1nd4A02 96 264

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


Domain ATOM Sequence

>pdb|1nd4A02
EVPGQDLLSSHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQGLAPAELFARLK
ARMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIALATRDIAEELGGEWADRFLVLYGIAAPDSQRIA
FYRLLDEFF    

Domain COMBS Sequence

>pdb|1nd4A02
EVPGQDLLSSHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQGLAPAELFARLK
ARMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIALATRDIAEELGGEWADRFLVLYGIAAPDSQRIA
FYRLLDEFF    

Domain History Events (11)

Domain assigned by auto on 20 Oct 2008 14:21

Assigning to "3.90.1200.10" based on similarity with "1nd4B02"

Flow stage update by auto on 20 Oct 2008 14:10

No in_process hits for Domain "1nd4A02" ready to be processed

Update comment by auto on 23 Jul 2008 18:05

Domain "1nd4A02" hits Domain "1nd4B02" (100% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 20:12

Domain "1nd4A02" hits Domain "1nd4B02" (100% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:19

Domain "1nd4A02" hits Domain "1nd4B02" (100% over 100%) which is currently in process

Update comment by auto on 14 Aug 2007 22:44

Domain "1nd4A02" hits Domain "1nd4B02" (100% over 100%) which is currently in process

Flow stage update by auto on 14 Mar 2007 15:09

Domain "1nd4A02" hits Domain "1nd4B02" (100% over 100%) which is currently in process

Flow stage update by auto on 14 Mar 2007 15:06

NW result present for Domain "1nd4A02"

Flow stage update by auto on 14 Mar 2007 15:02

All required files are present for Domain "1nd4A02"

Flow stage update by auto on 14 Mar 2007 15:00

Beginning processing for Domain "1nd4A02"

Insertion by auto on 13 Dec 2006 19:23

Final ChopClose added based on similarity with "1nd4B"