Domain assigned by auto on 20 Oct 2008 14:21
Assigning to "3.90.1200.10" based on similarity with "1nd4B02"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1nd4A01 | 10 | 95 |
| 1nd4A02 | 96 | 264 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1nd4A02 EVPGQDLLSSHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQGLAPAELFARLK ARMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIALATRDIAEELGGEWADRFLVLYGIAAPDSQRIA FYRLLDEFF
Assigning to "3.90.1200.10" based on similarity with "1nd4B02"
No in_process hits for Domain "1nd4A02" ready to be processed
Domain "1nd4A02" hits Domain "1nd4B02" (100% over 100%) which is currently in process
Domain "1nd4A02" hits Domain "1nd4B02" (100% over 100%) which is currently in process
Domain "1nd4A02" hits Domain "1nd4B02" (100% over 100%) which is currently in process
Domain "1nd4A02" hits Domain "1nd4B02" (100% over 100%) which is currently in process
Domain "1nd4A02" hits Domain "1nd4B02" (100% over 100%) which is currently in process
NW result present for Domain "1nd4A02"
All required files are present for Domain "1nd4A02"
Beginning processing for Domain "1nd4A02"
Final ChopClose added based on similarity with "1nd4B"