CATH Domain: 1nbuA00 XML data for domain: 1nbuA00

Molscript image for 1nbuA00
1nbuA00
PDB coordinates for domain 1nbuA00

PDB 1nbu, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1130 GTP Cyclohydrolase I, domain 2
3.30.1130.10 Gene3D
3.30.1130.10.5
3.30.1130.10.5.1
3.30.1130.10.5.1.1
3.30.1130.10.5.1.1.1
3.30.1130.10.5.1.1.1.1

[top]
Segment boundaries for domain 1nbuA00

Chopping figure for domain 1nbuA00
DomainStart PDB ResidueStop PDB Residue
1nbuA00 2 119

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.30.1130.10.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1b9lA00 88.77 Folic acid-containing compound metabolic processDihydroneopterin triphosphate 2'-epimerase activityD-erythro-7,8-dihydroneopterin triphosphate epimerase [EC:5.-.-.-]D-erythro-7,8-dihydroneopterin triphosphate epimeraseProtein binding 3.30.1130.10 119 22 97 1.85 1.90
3d7jC00 80.83 Putative uncharacterized protein SCO6650Streptomyces coelicolor 3.30.479.10 133 13 75 2.94 3.91
2g64A00 77.65 Caenorhabditis elegansIdentical protein binding6-pyruvoyl tetrahydrobiopterin synthase [EC:4.2.3.12]Putative 6-pyruvoyl tetrahydrobiopterin synthaseFolate biosynthesis 3.30.479.10 127 11 77 3.58 4.64
1y13A00 77.29 Metabolic pathwaysFolate biosynthesis6-pyruvoyl tetrahydrobiopterin synthase [EC:4.2.3.12]Plasmodium falciparum 3D76-pyruvoyltetrahydropterin synthase 3.30.479.10 162 10 63 3.17 4.99
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1nbuA00
ADRIELRGLTVHGRHGVYDHERVAGQRFVIDVTVWIDLAEAANSDDLADTYDYVRLASRAAEIVAGPPRKLIETVGAEIA
DHVMDDQRVHAVEVAVHKPQAPIPQTFDDVAVVIRRSR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1nbuA00
MADRIELRGLTVHGRHGVYDHERVAGQRFVIDVTVWIDLAEAANSDDLADTYDYVRLASRAAEIVAGPPRKLIETVGAEI
ADHVMDDQRVHAVEVAVHKPQAPIPQTFDDVAVVIRRSR
BLAST against CATH

[top]
Domain History Events (3)

Insertion by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Flow stage update by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Insertion by auto on 05 Mar 2006 23:28

Cut based on decision in database "DomChop" on "cathdb"