Set cath from cathlist by auto on 05 Mar 2006 19:33
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1n9gA01 | 23 | 175 |
| 1n9gA01 | 333 | 386 |
| 1n9gA02 | 176 | 332 |
There are 8 matching structural neighberhood comparisons for CATH ID 3.90.180.10.9.1.1.1.1 (SIMAX score < 5)
>pdb|1n9gA01 MITAQAVLYTQHGEPKDVLFTQSFEIDDDNLAPNEVIVKTLGSPINPSDINQIQGVYPSKPAKTTGFGTAEPAAPCGNEG LFEVIKVGSNVSSLEAGDWVIPSHVNFGTWRTHALGNDDDFIKLPNPAQSKANGKPNGLTINQGATISVNPLTLKTSTLN QIIAWYEEGKLTDAKSIETLYDGTKPLHELYQDGVANSKDGKQLITY
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"