CATH Domain: 1n8iA04 XML data for domain: 1n8iA04

Molscript image for 1n8iA04
1n8iA04
PDB coordinates for domain 1n8iA04

PDB 1n8i, Chain A, Domain 4

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1220 Malate Synthase G; Chain: A; Domain 4
1.20.1220.12 Gene3D
1.20.1220.12.2
1.20.1220.12.2.1
1.20.1220.12.2.1.1
1.20.1220.12.2.1.1.1
1.20.1220.12.2.1.1.1.1

[top]
Segment boundaries for domain 1n8iA04

Chopping figure for domain 1n8iA04
DomainStart PDB ResidueStop PDB Residue
1n8iA01 3 88
1n8iA02 135 263
1n8iA02 297 334
1n8iA03 89 134
1n8iA03 264 296
1n8iA03 335 590
1n8iA04 591 702

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.20.1220.12.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1v2zA00 82.44 Circadian clock protein kaiAThermosynechococcus vulcanus 1.10.1240.30 106 4 74 3.18 4.29
1ta8A01 77.18 DNA ligase (NAD+) [EC:6.5.1.2]DNA replicationNucleotide excision repairBase excision repairDNA ligase 1.10.287.610 64 3 56 2.47 4.37
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1n8iA04
PDEIREEVDNNCQSILGYVVRWVDQGVGCSKVPDIHDVALMEDRATLRISSQLLANWLRHGVITSADVRASLERMAPLVD
RQNAYRPMAPNFDDSIAFLAAQELILSG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1n8iA04
PDEIREEVDNNCQSILGYVVRWVDQGVGCSKVPDIHDVALMEDRATLRISSQLLANWLRHGVITSADVRASLERMAPLVD
RQNAGDVAYRPMAPNFDDSIAFLAAQELILSG
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:19

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"