Insertion by sillitoe on 06 Mar 2006 15:53
HomCheck 'New T' domains
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1n7vA01 | 2 | 42 |
| 1n7vA01 | 420 | 555 |
| 1n7vA02 | 43 | 66 |
| 1n7vA02 | 321 | 419 |
| 1n7vA03 | 67 | 157 |
| 1n7vA03 | 158 | 239 |
| 1n7vA03 | 240 | 320 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1n7vA03 YNPRTENNPAGNCAFAFNPFGQYISNISSAQSVHRRIYGIDLNDEPLFSPNAASITNGGNPTMSQDTGYHNIGPINTAYK AEIFRPVNPLPMSDTAPDPETLEPGQTEPLIKSDGVYSNSGIASFIFDRPVTEPNPNWPPLPPPVIPIIYPTPALGIGAA AAYGFGYQVTVYRWEEIPVEFLNPEGSPCAYEAGIILVRQTSNPMNAVAGRLVPYVEDIAVDIFLTGKFFTL
HomCheck 'New T' domains
HomCheck 'New T' domains
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"