Set cath from cathlist by auto on 05 Mar 2006 18:47
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1n7oA01 | 548 | 804 |
| 1n7oA02 | 171 | 542 |
| 1n7oA03 | 805 | 889 |
There are 4 matching structural neighberhood comparisons for CATH ID 2.60.220.10.2.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1f1sA03 | 89.11 | 2.60.220.10 | 82 | 31 | 96 | 2.04 | 2.11 | |
![]() |
1cb8A03 | 81.77 | 2.60.220.10 | 110 | 12 | 73 | 2.57 | 3.49 | |
![]() |
1x1iA03 | 79.37 | 2.60.220.10 | 118 | 12 | 62 | 2.85 | 4.54 | |
| 2qzuA02 | 73.72 | 3.30.1120.10 | 84 | 8 | 60 | 2.73 | 4.55 |
>pdb|1n7oA03 TFNQMIKELESSLIENNETLQSVYDAKQGVWGIVKYDDSVSTISNQFQVLKRGVYTIRKEGDEYKIAYYNPETQESAPDQ EVFKK
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"