Set cath from cathlist by auto on 05 Mar 2006 19:32
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1n7hB01 | 221 | 254 |
| 1n7hB01 | 284 | 320 |
| 1n7hB01 | 338 | 367 |
| 1n7hB02 | 28 | 220 |
| 1n7hB02 | 255 | 283 |
| 1n7hB02 | 321 | 337 |
There are 1 matching structural neighberhood comparisons for CATH ID 3.90.25.10.10.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1eq2D02 | 81.36 | 3.90.25.10 | 101 | 8 | 74 | 2.36 | 3.18 |
>pdb|1n7hB01 GENFVTRKITRALGRIKVGLQTKLFLGNLQASRDGHTVEEFLDVSFGYLGLNWKDYVEIDQRYFRPAEVDNVGFEKLVKM MVDEDLELAKREKVLVDAGYM
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"