Insertion by sillitoe on 06 Mar 2006 15:40
HomCheck 'Assigned H' domains
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1n4wA01 | 9 | 155 |
| 1n4wA01 | 216 | 322 |
| 1n4wA01 | 385 | 405 |
| 1n4wA01 | 443 | 507 |
| 1n4wA02 | 156 | 215 |
| 1n4wA02 | 323 | 384 |
| 1n4wA02 | 406 | 442 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1n4wA02 RVNHIDTKWFEDTEWYKFARVSREQAGKAGLGTVFVPNVYDFGYMQREAAGEVPKSALATNIMTARANHMWNPTGAHQSS IPALGIDAWDNSDSSVFAEIAPMPAGLETWVSLYLAITKNPQNAPAVNAAKALFDRINKANGTIYRYDLFGTQLKAFAD