Domain assigned by cuff on 11 Mar 2009 20:42
homology match
CATH Domain: 1n4cA01
1n4cA01
PDB 1n4c, Chain A, Domain 1
| CATH Code | Level Description | Links |
|---|---|---|
 1
| Mainly Alpha | |
 1.10
| Orthogonal Bundle | |
 1.10.287
| Helix Hairpins | |
 1.10.287.110
| Gene3D | |
 1.10.287.110.10
| ||
 1.10.287.110.10.1
| ||
 1.10.287.110.10.1.1
| ||
 1.10.287.110.10.1.1.1
| ||
 1.10.287.110.10.1.1.1.1
|
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|1n4cA01 FEDLLSGQGFNAHKDKKGPRTIAEMRKEEMAKEMDPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVT PEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAWSEFENQGQK
Domain History Events (41)
Domain assignment manual match h by tronnberg on 04 Jan 2008 16:35
SSAP: 84.3 OV: 70 SEQ: 94. Share the same function as Auxilin.
Homcheck review by tronnberg on 04 Jan 2008 16:35
SSAP: 84.3 OV: 70 SEQ: 94. Share the same function as Auxilin.
Flow stage update by tronnberg on 04 Jan 2008 16:35
SSAP: 84.3 OV: 70 SEQ: 94. Share the same function as Auxilin.
Homcheck allotment by tronnberg on 04 Jan 2008 16:33
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by tronnberg on 04 Jan 2008 16:33
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 27 Dec 2007 12:57
Calculated SCOP results for 1n4cA01 and inserted them into the database.
Domain scan scop cath by auto on 27 Dec 2007 12:57
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 26 results for 1n4cA01
Flow stage update by auto on 27 Dec 2007 11:54
Retrieved PRC_PFAMCATH results for job ID SID8374663089824594 and results inserted.
Domain scan prc pfamcath by auto on 27 Dec 2007 11:54
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 9 results for 1n4cA01
Update comment by auto on 27 Dec 2007 00:23
PRC_PFAMCATH job SID8374663089824594 is not yet finished.
Prc pfamcath submit by auto on 27 Dec 2007 00:17
The entry "1n4cA01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 27 Dec 2007 00:17
The entry "1n4cA01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 27 Dec 2007 00:01
Retrieved SSAP results for job ID SID9264261949495424 and results inserted.
Domain scan ssap cath by auto on 26 Dec 2007 23:57
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1204 results for 1n4cA01
Update comment by auto on 26 Dec 2007 05:55
SSAP job SID9264261949495424 is not yet finished.
Ssap cath submit by auto on 26 Dec 2007 05:33
The entry "1n4cA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 26 Dec 2007 05:33
The entry "1n4cA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 26 Dec 2007 05:31
Retrieved PRC results for job ID SID3661485672889376 and inserted them into the database.
Domain scan prc cath by auto on 26 Dec 2007 05:30
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 10 results for 1n4cA01
Update comment by auto on 25 Dec 2007 23:31
PRC job SID3661485672889376 is not yet finished.
Prc cath submit by auto on 25 Dec 2007 23:26
The entry "1n4cA01" has been submitted to the PRC webservice.
Flow stage update by auto on 25 Dec 2007 23:26
The entry "1n4cA01" has been submitted to the PRC webservice.
Flow stage update by auto on 25 Dec 2007 23:25
Retrieved HMM(SAM) results for job ID SID4431613334689536 and inserted them into the database.
Domain scan sam cath by auto on 25 Dec 2007 23:24
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 9 results for 1n4cA01
Update comment by auto on 25 Dec 2007 20:27
HMM(SAM) job SID4431613334689536 is not yet finished.
Sam cath submit by auto on 25 Dec 2007 20:22
The entry "1n4cA01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 25 Dec 2007 20:22
The entry "1n4cA01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 25 Dec 2007 20:20
Retrieved "1n4cA01" CATHEDRAL results for job ID SID0165710768295364 and inserted them into the database.
Domain scan cathedral cath by auto on 25 Dec 2007 20:19
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 105 results for 1n4cA01
Update comment by auto on 25 Dec 2007 17:23
"1n4cA01" CATHEDRAL job SID0165710768295364 is not yet finished.
Flow stage update by auto on 25 Dec 2007 17:19
The entry "1n4cA01" has been submitted to the CATHEDRAL webservice.
Cathedral cath submit by auto on 25 Dec 2007 17:19
The entry "1n4cA01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 25 Dec 2007 17:18
ScanList with 11656 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/1n4cA01.scanlist" for "1n4cA01"
Write scan list by auto on 25 Dec 2007 17:18
Writing ScanList containing 11656 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/1n4cA01.scanlist" for domain "1n4cA01"
Flow stage update by auto on 19 Aug 2007 02:25
No satisfactory AssignClose result found.
Flow stage update by auto on 19 Aug 2007 02:16
No in_process hits for Domain "1n4cA01" ready to be processed
Flow stage update by auto on 19 Aug 2007 02:16
NW result present for Domain "1n4cA01"
Flow stage update by auto on 16 Aug 2007 17:15
All required files are present for Domain "1n4cA01"
Flow stage update by auto on 16 Aug 2007 00:02
Beginning processing for Domain "1n4cA01"
Insertion by cuff on 15 Aug 2007 12:45
nice chopping
