CATH Domain: 1n45A00 XML data for domain: 1n45A00

Molscript image for 1n45A00
1n45A00
PDB coordinates for domain 1n45A00

PDB 1n45, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.910 Heme Oxygenase; Chain A
1.20.910.10 Heme Oxygenase; Chain A Gene3D
1.20.910.10.4
1.20.910.10.4.1
1.20.910.10.4.1.1
1.20.910.10.4.1.1.1
1.20.910.10.4.1.1.1.1

[top]
Segment boundaries for domain 1n45A00

Chopping figure for domain 1n45A00
DomainStart PDB ResidueStop PDB Residue
1n45A00 10 223

Structural Neighbourhood (9 entries)

There are 9 matching structural neighberhood comparisons for CATH ID 1.20.910.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 9 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1j02A00 95.12 DNA damage response, signal transduction resulting in induction of apoptosisRattus norvegicusRegulation of blood pressureNucleolusResponse to hydrogen peroxide 1.20.910.10 212 84 99 1.16 1.17
1j77A00 84.26 Heme oxygenaseHemONeisseria meningitidis 1.20.910.10 199 16 88 3.32 3.74
1sk7A00 84.17 Pseudomonas aeruginosaHeme oxygenaseHeme oxygenase 1.20.910.10 187 17 85 2.61 3.04
2qcxA00 82.33 Thiamine metabolismBacillus subtilisThiaminase-2Transcriptional activator TenA [EC:3.5.99.2] 1.20.910.10 222 10 93 4.15 4.43
1uddA00 82.24 Thiamine metabolismPyrococcus horikoshiiTranscriptional activator TenA [EC:3.5.99.2]218aa long hypothetical transcriptional regulator 1.20.910.10 215 7 95 4.03 4.21
1rtwB00 81.64 Pyrococcus furiosusTranscriptional activator, putative 1.20.910.10 204 8 92 3.83 4.14
3bjdA02 79.78 Pseudomonas aeruginosaPutative uncharacterized protein 1.20.910.10 217 8 92 3.85 4.18
1rcwB00 78.33 Chlamydia trachomatisPqqC-like proteinPyrroloquinoline-quinone synthase [EC:1.3.3.11] 1.20.910.10 210 10 92 4.14 4.45
3hlxA00 77.52 Pyrroloquinoline-quinone synthase [EC:1.3.3.11]Klebsiella pneumoniae subsp. pneumoniae MGH 78578Pyrroloquinoline-quinone synthase 1.20.910.10 247 9 80 3.38 4.17
[1]
Displaying entries 1 to 9 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1n45A00
PQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAAL
EQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTF
PNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTH
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1n45A00
MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFP
EELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSS
GEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRA
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:19

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:19

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:41

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"