CATH Domain: 1n40A00 XML data for domain: 1n40A00

Molscript image for 1n40A00
1n40A00
PDB coordinates for domain 1n40A00

PDB 1n40, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.630 Cytochrome p450
1.10.630.10 Cytochrome p450 Gene3D
1.10.630.10.2
1.10.630.10.2.1
1.10.630.10.2.1.1
1.10.630.10.2.1.1.1
1.10.630.10.2.1.1.1.1

[top]
Segment boundaries for domain 1n40A00

Chopping figure for domain 1n40A00
DomainStart PDB ResidueStop PDB Residue
1n40A00 2 396

Structural Neighbourhood (15 entries)

There are 15 matching structural neighberhood comparisons for CATH ID 1.10.630.10.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 15 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2zbxA00 86.61 Streptomyces griseolusCytochrome P450-SU1 1.10.630.10 398 26 97 2.57 2.64
2z3tA00 85.57 Cytochrome P450Streptomyces sp. TP-A0274 1.10.630.10 385 25 94 3.74 3.94
1s1fA00 85.38 Biflaviolin synthase [EC:1.14.21.7]Streptomyces coelicolorPutative cytochrome P450 1.10.630.10 397 23 96 2.99 3.10
1t2bA00 84.63 Citrobacter braakiiP450cin 1.10.630.10 397 21 94 2.93 3.09
1io7A00 84.17 Sulfolobus acidocaldariusCytochrome P450 119[EC:1.14.14.-] 1.10.630.10 366 23 88 4.23 4.78
1q5dA00 83.91 Epothilone biosynthetic processCytochrome P450 167A1Sorangium cellulosum 1.10.630.10 401 20 95 3.16 3.33
1odoA00 83.78 Streptomyces coelicolorPutative cytochrome P450 1.10.630.10 395 23 95 2.91 3.05
1lfkA00 83.43 Amycolatopsis orientalisCytochrome P450 165B3 1.10.630.10 375 21 92 3.29 3.57
1cptA00 83.29 Pseudomonas sp.Cytochrome P450-terp 1.10.630.10 412 21 93 3.52 3.77
2zwuA00 82.56 Camphor 5-monooxygenasePseudomonas putida 1.10.630.10 394 17 93 3.34 3.56
1n97A00 80.52 Thermus thermophilus HB27Cytochrome P450 1.10.630.10 385 15 88 3.38 3.82
2ij2B00 78.64 Bacillus megateriumBifunctional P-450/NADPH-P450 reductase 1.10.630.10 448 15 83 3.73 4.44
1izoA00 77.96 Bacillus subtilisLimonene and pinene degradationNaphthalene and anthracene degradationGamma-Hexachlorocyclohexane degradationCytochrome P450 152A1 1.10.630.10 411 14 88 3.79 4.28
3czhA00 77.33 Vitamin D 25-hydroxylaseHomo sapiensCytochrome P450, family 2, subfamily R 1.10.630.10 465 13 81 3.80 4.66
1tqnA00 76.12 Vitamin D 24-hydroxylase activityCell surfaceSteroid bindingSteroid hormone biosynthesisMetabolic pathways 1.10.630.10 468 12 80 3.90 4.87
[1]
Displaying entries 1 to 15 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1n40A00
TATVLLEVPFSARGDRIPDAVAELRTREPIRKVRTITGAEAWLVSSYALCTQVLEDRRFSMKETAAAGAPRLNALTVPPE
VVNNMGNIADAGLRKAVMKAITPKAPGLEQFLRDTANSLLDNLITEGAPADLRNDFADPLATALHCKVLGIPQEDGPKLF
RSLSIAFMSSADPIPAAKINWDRDIEYMAGILENPNITTGLMGELSRLRKDPAYSHVSDELFATIGVTFFGAGVISTGSF
LTTALISLIQRPQLRNLLHEKPELIPAGVEELLRINLSFADGLPRLATADIQVGDVLVRKGELVLVLLEGANFDPEHFPN
PGSIELDRPNPTSHLAFGRGQHFCPGSALGRRHAQIGIEALLKKMPGVDLAVPIDQLVWRTRFQRRIPERLPVLW
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1n40A00
MTATVLLEVPFSARGDRIPDAVAELRTREPIRKVRTITGAEAWLVSSYALCTQVLEDRRFSMKETAAAGAPRLNALTVPP
EVVNNMGNIADAGLRKAVMKAITPKAPGLEQFLRDTANSLLDNLITEGAPADLRNDFADPLATALHCKVLGIPQEDGPKL
FRSLSIAFMSSADPIPAAKINWDRDIEYMAGILENPNITTGLMGELSRLRKDPAYSHVSDELFATIGVTFFGAGVISTGS
FLTTALISLIQRPQLRNLLHEKPELIPAGVEELLRINLSFADGLPRLATADIQVGDVLVRKGELVLVLLEGANFDPEHFP
NPGSIELDRPNPTSHLAFGRGQHFCPGSALGRRHAQIGIEALLKKMPGVDLAVPIDQLVWRTRFQRRIPERLPVLW
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:14

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:14

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:35

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"